Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5500
Next month in: 01:48:42
Server time: 18:11:17, June 17, 2024 CET
Currently online (4): AethanKal | itsjustgav | ReddNEK | Tayes_Gad | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Democratic Party of Sekowo[?]

This page contains information about the Democratic Party of Sekowo.

This party is inactive.

Details

User[?]: morgalorgaqqq

Nation[?]: Dai Sekouokoku (Seko)

Seats[?] in 国会 - Kokkai (Imperial Diet) [?]: 0

Color[?]:

 

Description[?]:

We consider our greatest achievement so far to be the abolishment of the monarchy that we accomplished together with the Liberty Party. Our next goal, and what is to be even greater, is to make Sekowo the envy of the world.
Formerly the Anti-Royalty Party

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate regulatorlimitedperfect
Militarymoderate pacifisthighperfect
Moralityconservative-leaningexcellentperfect
Religionsecular-leaninghighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 429724,19054,634,0040.04+0.0402020.00+0
April 430044,66752,652,2830.08+0.0402020.00+0
April 430516,417,02563,889,12725.70+25.615320226.24+53
April 43109,790,35637,242,30026.29+0.596220230.69+9
June 43118,333,41746,340,73417.98-8.3114275018.93+80
June 431615,338,34759,291,64725.87+7.8919675026.13+54
July 43186,024,08465,642,9759.18-16.69687509.07-128
September 43205,519,58859,445,2909.29+0.11444779.22-24

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Democratic Party of Sekowo.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374

BillCreatedVoting startedVoteBill StatusResult
Public Housing Act (2909)November 2909November 2909passed
Ratification of the Northern Area Treaty Organization (NATO)September 2909September 2909defeated
Morality Act (2909)July 2909July 2909defeated
Population Enhancement Act (2909)July 2909July 2909defeated
Stock Market Nationalization (2909)July 2909July 2909defeated
Emergencies Act 2909March 2909October 2909passed
Prison Labor Act 2909March 2909March 2909passed
Eminent Domain Act 2909 (Amended)March 2909March 2909passed
Energy Privatization Act 2909February 2909February 2909passed
Eminent Domain Act 2909February 2909February 2909passed
Public Transport Act 2909February 2909February 2909passed
Public Works Act 2909February 2909February 2909passed
Pension Reform Act 2909February 2909February 2909passed
Religious Schools Act 2909February 2909February 2909passed
Religious Taxation Act 2909February 2909February 2909passed
Salary Cap (2909)January 2909January 2909defeated
Recreational Drug Use Act 2911December 2908April 2911passed
Forestry Act 2908October 2908October 2909passed
Animal Testing Act 2908October 2908February 2909passed
Cybercrime Act 2908October 2908February 2909passed

Random fact: When elections in a country are held, all bills in the voting phase are reset to the debate phase.

Random quote: "A free people ought not only to be armed and disciplined, but they should have sufficient arms and ammunition to maintain a status of independence from any who might attempt to abuse them, which would include their own government." - George Washington

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52