Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:20:43
Server time: 16:39:16, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Baltusian Ultranationalist Party (BUP)[?]

This page contains information about the Baltusian Ultranationalist Party (BUP).

This party is inactive.

Details

User[?]: pauljew

Nation[?]: Syndicalist Union of Autonomous States (Baltusia)

Seats[?] in Congress of Trade Unions[?]: 0

Color[?]:

 

Description[?]:

The Baltusian Ultranationalist Party (BUP) Was founded in December 3978 by Paul Wolfe, the Parties candidate for Head of Government. The parties values from 1-3 in order of importance are as follows. #1 Protecting the Baltusian Race and Culture from outside influence and cultural enrichment, #2 Defending traditional values and stopping leftist ideas, #3 Making this countries military the strongest in the continent.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistclose to noneperfect
Government Responsibilitiesconvinced big governmentmoderateperfect
Marketconvinced regulatormoderateperfect
Militaryconvinced militaristhighperfect
Moralitymoderate progressiveclose to noneperfect
Religionunknownclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 398021,892,45550,124,33143.68+43.6835575047.33+355
March 398213,355,73937,959,65835.18-8.4925475033.87-101
March 39847,179,97712,495,74057.46+22.2843675058.13+182

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Baltusian Ultranationalist Party (BUP).

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722

BillCreatedVoting startedVoteBill StatusResult
Prayers in school act March 4506March 4506March 4506defeated
Minimum income act March 4506March 4506March 4506defeated
Homosexuality in the military reform act March 4506March 4506March 4506defeated
Eminent domain act March 4506March 4506March 4506defeated
Free to Educate ActFebruary 4506February 4506passed
National military service reform act February 4506February 4506February 4506defeated
Gun control deregulation February 4506February 4506February 4506passed
Crossdressing ban act February 4506February 4506February 4506passed
Forest management reform February 4506February 4506February 4506defeated
Civil defense act January 4506January 4506January 4506passed
Citizenship rights act January 4506January 4506January 4506defeated
Cabinet Proposal of October 4504October 4504October 4504passed
Common Sense Gun Reform Act of 4504 (President J.P. Murray Act)June 4504November 4504passed
Religious Freedoms ActApril 4504October 4504defeated
Cabinet Proposal of November 4502November 4502November 4502passed
Ratification of the Anantonese Ocean TreatyMarch 4502March 4502passed
President J.P. Murray's Presidential CabinetOctober 4501February 4502defeated
President J.P. Murray’s CabinetJanuary 4501January 4501defeated
Adoption of a new National AnthemNovember 4498November 4500defeated
Minimum Basic Income (MBI) Act of 4498November 4498November 4498passed

Random fact: Moderation will not accept Cultural Protocol updates which introduce, on a significant scale, cultures which are likely to be insufficiently accessible to players. In particular, for all significant cultures in Particracy, it should be easy for players to access and use online resources to assist with language translation and the generation of character names. Moderation reserves the right to amend Cultural Protocols which are deemed to have introduced significant cultures that are not sufficiently accessible and which are not being actively role-played with.

Random quote: "The secret of freedom lies in educating people, whereas the secret of tyranny is in keeping them ignorant." - Maximilien Robespierre

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51