Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5493
Next month in: 03:13:14
Server time: 04:46:45, June 04, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Hulstrian Nationalist Party[?]

This page contains information about the Hulstrian Nationalist Party.

This party is inactive.

Details

User[?]: AgainstMe!

Nation[?]: Mikuni-Hulstria (Hulstria and Gao-Soto)

Seats[?] in Parlament/Gikai[?]: 0

Color[?]:

 

Description[?]:

The Hulstrian Nationalist Party is dedicated to protecting the interests of Hulstrians, and securing greater political and economic freedom for them. We believe strongly in the importance of defence, and economic and military superiority over our neighbors. Internal security is also very important to us, and those that provide danger or harm to our nation must be dealt with harshly.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate restrictiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketmoderate regulatorexcellentperfect
Militarypacifist-leaningmoderateperfect
Moralityconvinced conservativemoderateperfect
Religionmoderate religioushighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 245780,58990,184,0320.09+0.0905000.00+0
January 246068,87492,504,0700.07-0.0105000.00+0
January 24636,698,83088,707,3267.55+7.48365007.20+36
January 24668,037,54890,257,0728.91+1.35435008.60+7
February 246611,066,15385,107,17713.00+4.106350012.60+20
February 24698,778,74191,168,7219.63-3.37485009.60-15
September 247019,045,88662,170,14530.64+21.0115450030.80+106
September 247310,730,93088,351,48412.15-18.496050012.00-94
February 24758,181,68685,142,7239.61-2.54485009.60-12
February 247814,238,17885,764,95816.60+6.998350016.60+35
July 247910,524,36091,140,59011.55-5.055750011.40-26
July 24826,644,15788,606,8577.50-4.05355007.00-22
July 24855,862,16992,572,3986.33-1.17295005.80-6
July 24889,303,52194,414,0329.85+3.52465009.20+17
July 24919,315,40199,821,7419.33-0.52455009.00-1
February 249410,104,70897,231,96010.39+1.065050010.00+5
February 24978,637,85897,688,1528.84-1.55435008.60-7
February 25006,795,457100,881,8236.74-2.11335006.60-10
December 25018,514,131102,667,6618.29+1.56405008.00+7
December 250211,262,978100,904,77011.16+2.875250010.40+12
December 25058,989,432101,444,3368.86-2.30425008.40-10
December 250810,859,740106,515,84310.20+1.335050010.00+8
December 25119,841,314102,049,4169.64-0.55465009.20-4
December 25149,066,98199,921,2029.07-0.57445008.80-2
December 25174,599,603102,511,1844.49-4.59225004.40-22
December 25209,667,009100,653,1679.60+5.12485009.60+26
December 252310,036,55386,632,79211.59+1.986050012.00+12
December 25268,543,06896,081,0878.89-2.69445008.80-16
December 252911,701,78597,540,55112.00+3.115750011.40+13

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Hulstrian Nationalist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495

BillCreatedVoting startedVoteBill StatusResult
Chemical Weapons Act of 3215March 3125March 3125defeated
General Reforms Act of 3124July 3124July 3124defeated
Cabinet Proposal of September 3123September 3123September 3123passed
Gaming Entertainment Purchase Reform Act of 3123April 3123April 3123passed
Adoption Freedom Act of 3122December 3122December 3122defeated
Nondispersal Act of 3122December 3122December 3122defeated
Freedom of Dress Act of 3122December 3122December 3122defeated
Nuclear Power Elimination Act of 3122December 3122December 3122defeated
Religious Freedom of Control Act of 3122December 3122December 3122defeated
Dress Code Elimination Act of 3122December 3122December 3122defeated
Ministerial Salary Act of 3122December 3122December 3122defeated
Religious Freedom Act of 3122December 3122December 3122defeated
Eminent Domain Act of 3122December 3122December 3122defeated
School Secularism Act, 3122November 3122November 3122defeated
Defence Industry Operations Reform Act of 3121June 3121June 3121passed
Coronation of Alexander IIDecember 3120December 3120passed
Coronation of Alexander IIMarch 3119October 3119defeated
Educational Cost Reform ActJune 3118June 3118defeated
Health Care Reform ActOctober 3116October 3116defeated
Cabinet Proposal of October 3116October 3116October 3116defeated

Random fact: In Culturally Protected nations, it is the responsibility of players to ensure the candidate boxes on their Party Overview screens are filled in with appropriate names. If a player is allotted seats in a Cabinet bill and has not filled in names for the relevant candidate position, then the program will automatically fill in the positions with names which might not necessarily be appropriate for the Cultural Protocols.

Random quote: "One day our descendants will think it incredible that we paid so much attention to things like the amount of melanin in our skin or the shape of our eyes or our gender instead of the unique identities of each of us as complex human beings." - Franklin Thomas

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51