Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 01:31:24
Server time: 18:28:35, November 24, 2024 CET
Currently online (1): Mindus | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Social Republican Party[?]

This page contains information about the Social Republican Party.

This party is inactive.

Details

User[?]: Cor Shan

Nation[?]: Māliva Janaparishadsanghah (Malivia)

Seats[?] in प्रतिनिधि सभा (Pratinidhi Sabhā - House of Representatives)[?]: 0

Color[?]:

 

Description[?]:

A centrist party means some things. Obvious things.

Centrism does not include the government stealing the life's work of certain individuals (we'll call them WORKERS) to provide a better standard of living for their comrades.

Life is solitary, poor, nasty, brutish, and short, especially under the communist reign. Well, maybe not solitary. We are all equal in our misery, comrade!
The commies want to to believe that life is miserable and they are making it better. If that was true, then we would lay down our voices and return to our normal lives. Of course, their propaganda is false. Life is miserable, but only because they prevent any opportunity to make it better. Should an innocent worker start work for oneself in a 'major' industry (note that the government refuses to publish what is and isn't major) one's life's effort will be 'nationalized'. What that means is that one's work will be equalized, so that others (we will call them FREELOADERS) benefit, while the WORKER gets next to nothing.

We are not heartless. We want everyone to have a home, a job, heath, an education. But what we provide must be a starting line, not the final level. Why? Because no state, even a democratic one, knows everything, so what ability do they have to administer all education? Likewise for the others. People should have a freedom to live, to work, and to heal as they will.

The government must be a democratic republic, as, next to anarchy, it is the least of all evils. If we accept the government's authority as absolute, then we trust it. If we trust the government, certain members of society will try to enter the government to earn trust, which they will abuse. Thus the government's rule must never be absolute.
Should it be absolute, then certain voices would be extinguished. Such as two voices for equality in business, for opportunity, and for freedom!

Liberty or death!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketmoderate regulatorexcellentperfect
Militarymilitarist-leaninglimitedperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 20683,187,72920,744,24915.37+15.371610016.00+16
April 20702,462,44620,567,61911.97-3.391310013.00-3
April 20722,642,89221,629,10412.22+0.251210012.00-1
April 20743,989,01622,183,09017.98+5.761910019.00+7
April 20764,310,76021,201,48120.33+2.352310023.00+4
April 20783,509,09524,404,71214.38-5.951510015.00-8
April 20803,645,01725,320,13314.40+0.021310013.00-2
April 20824,032,77624,684,15716.34+1.941710017.00+4
April 20846,519,45224,928,69526.15+9.812910029.00+12
April 20865,328,06025,403,29420.97-5.182210022.00-7
April 20883,887,53723,253,76116.72-4.261710017.00-5
April 20904,039,90225,699,01615.72-1.001610016.00-1
April 20982,695,36925,868,21710.42-5.301010010.00-6
May 20993,039,58421,752,23313.97+3.551410014.00+4
May 21012,538,31621,201,13411.97-2.001210012.00-2
May 21033,134,88521,222,50714.77+2.801510015.00+3
May 21053,535,78625,753,57513.73-1.041410014.00-1
May 21073,564,54722,898,48815.57+1.841510015.00+1
May 21093,969,83726,434,73815.02-0.551510015.00+0
May 21115,290,52226,956,05919.63+4.612010020.00+5
May 21135,487,42327,088,85420.26+0.632010020.00+0
May 21155,157,35225,964,14219.86-0.392010020.00+0
May 21175,510,99025,547,62721.57+1.712210022.00+2
May 21195,629,81626,308,77821.40-0.172110021.00-1
May 21214,673,65328,055,89316.66-4.741710017.00-4
May 21234,688,02127,880,78516.81+0.161710017.00+0
May 21254,464,12531,981,40713.96-2.861410014.00-3
May 21274,288,06126,711,24816.05+2.091610016.00+2
May 21292,472,62429,283,7398.44-7.61253018.31+9
June 21312,221,06130,200,8257.35-1.09203016.64-5

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Social Republican Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415

BillCreatedVoting startedVoteBill StatusResult
Whale Conservation Act of 3463 (RPM 16)May 3463May 3463defeated
Industrial Relations Act of 3463 (RPM 15)April 3463April 3463defeated
Software-Related Intellectual Property Law Reform Act of 3463 (RPM 14)April 3463April 3463defeated
Death Penalty Abolition Act of 3463 (RPM 13)April 3463April 3463defeated
Eminent Domain Equity Act of 3463 (RPM 12)February 3463February 3463defeated
Agricultural Policy Act of 3463 (RPM 11)February 3463February 3463defeated
Natural Monopoly Regulation Act of 3463 (RPM 10)February 3463February 3463defeated
Slavery Abolition Act of 3462 (RPM 9)August 3462August 3462defeated
Food Labeling Act 3462 (RPM 8)August 3462August 3462defeated
International Realignment Act of 3462 (RPM 7)August 3462August 3462defeated
Call for early elections, April 3462 (RPM 6)April 3462April 3462defeated
Election Reform Act of (RPM 5)April 3462April 3462defeated
The Weapons of Mass Destruction Prohibition Act of 3462 (RPM 4)April 3462April 3462defeated
Religious Freedom Act of 3462 (RPM 3)April 3462April 3462defeated
Civilian Public Service Reform Act of 3462 (RPM 2)April 3462April 3462defeated
Enfranchisement Act of 3426 (RPM 1)April 3462April 3462defeated
Cabinet Proposal of April 3454April 3454April 3454passed
Back to the BloodOctober 3453October 3453passed
Repelling the National Orgainsations ActOctober 3453October 3453passed
Call for early elections, April 3453April 3453April 3453passed

Random fact: There are two countries based on Egypt in the game. Cobura is based on modern Egypt with a retro twist, while Hawu Mumenhes is based on Ancient Egypt with a modernist twist.

Random quote: "If a female president can come here and be treated equally, why can't any other woman?" - Jewell C. Stillman, former Lourennais politician (on equal rights in Badara)

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51