Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5498
Next month in: 01:05:39
Server time: 22:54:20, June 12, 2024 CET
Currently online (1): Tayes_Kaf | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Capitalism Now ![?]

This page contains information about the Capitalism Now !.

This party is inactive.

Details

User[?]: Moestasch

Nation[?]: Ikradonian Union (Ikradon)

Seats[?] in Federale Kamer (Federal Chamber)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate regulatormoderateperfect
Militarymoderate militaristlimitedperfect
Moralitymoderate progressivelimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 32087,377,68764,754,09611.39+11.398775011.60+87
November 32118,938,05564,463,29313.87+2.4710775014.27+20
May 32159,670,40262,838,90815.39+1.5211975015.87+12
November 32188,936,08963,027,69114.18-1.2110775014.27-12
November 32228,146,19462,492,42313.04-1.1410275013.60-5
October 32247,626,27460,453,42012.62-0.429875013.07-4
October 32287,624,79760,250,05312.66+0.0410075013.33+2
October 32325,719,07161,316,7599.33-3.33727509.60-28
April 32365,883,23159,292,7179.92+0.607575010.00+3
February 32389,732,41058,770,91016.56+6.6412875017.07+53
February 32427,605,19359,378,21812.81-3.759775012.93-31
February 32464,329,19153,952,1508.02-4.78587507.73-39
February 32509,530,40556,988,55416.72+8.7012375016.40+65
February 325410,329,36262,737,69816.46-0.2612175016.13-2
February 32589,118,34357,314,17215.91-0.5511975015.87-2
February 326210,207,80658,568,01817.43+1.5213175017.47+12
February 326610,701,62752,661,99420.32+2.8915375020.40+22
February 327010,421,88255,841,50018.66-1.6614075018.67-13
February 327411,035,06154,106,11420.40+1.7315175020.13+11
February 327812,110,37762,285,59019.44-0.9514675019.47-5

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Capitalism Now !.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383

BillCreatedVoting startedVoteBill StatusResult
Pension actNovember 2608November 2608defeated
Equal RepresentationDecember 2607December 2607passed
Cabinet Proposal of December 2607December 2607December 2607passed
A Change of NameJuly 2607January 2609passed
PLF: A more friendly military policy.June 2607May 2611defeated
Justice Act of 2607June 2607December 2607defeated
Axis IssuesMay 2607December 2607passed
Eminent Domain Act of 2607February 2607February 2607passed
Dissent ActFebruary 2607February 2607defeated
Abolishment of Religion Act 2607February 2607February 2607defeated
ColonizationJanuary 2607February 2608passed
Budget proposal of January 2607January 2607January 2607passed
Socio-Environmental BillJanuary 2607January 2607passed
LPI ManifestoJune 2606August 2606defeated
The defense billMay 2606May 2606passed
Income tax proposal of May 2606May 2606May 2606passed
Social BillFebruary 2606February 2606defeated
Second Environment BillSeptember 2605January 2606defeated
Tax ActJanuary 2605February 2605passed
Evironment BillDecember 2604December 2604passed

Random fact: Party candidates for head of state elections are not visible to the public. This means that you cannot see who will run and who will not, which adds another strategic element to the elections.

Random quote: "Depressions and mass unemployment are not caused by the free market but by government interference in the economy." - Ludwig von Mises

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51