Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5499
Next month in: 03:14:52
Server time: 08:45:07, June 16, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


National Fascist Party[?]

This page contains information about the National Fascist Party.

This party is inactive.

Details

User[?]: Myles Mahoney

Nation[?]: Gran Prinċipat ta’ Kildanja (Cildania)

Seats[?] in Kunsill tad-Deputati (Council of Deputies)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiesmoderate small governmenthighperfect
Marketmoderate regulatorexcellentperfect
Militaryconvinced militaristlimitedperfect
Moralityconvinced conservativehighperfect
Religionreligious-leaninghighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
September 269410,848,780169,734,7186.39+6.39122105.71+12
January 269828,115,353168,681,98116.67+10.283521016.67+23
May 270122,275,771170,909,33513.03-3.632721012.86-8
September 270417,504,363174,345,60410.04-2.992121010.00-6
March 270831,579,896177,972,13617.74+7.703721017.62+16
September 271137,118,961185,377,80120.02+2.284221020.00+5
March 271542,811,015176,050,34524.32+4.295021023.81+8
September 271833,236,237181,259,71618.34-5.983921018.57-11
March 272238,049,535188,720,73620.16+1.834321020.48+4
September 272535,446,332172,040,90120.60+0.444221020.00-1
March 272935,088,577170,770,06120.55-0.064221020.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the National Fascist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448

BillCreatedVoting startedVoteBill StatusResult
Acts of Union 3021January 3021January 3021defeated
Cabinet Proposal of January 3021January 3021January 3021passed
National Motto Act of 3020December 3020December 3020passed
Elcetion Reform Act of 3020December 3020December 3020passed
State Secularism Act of 3020December 3020December 3020passed
State Secularism Act of 3018December 3018December 3018defeated
Military Reform Act of 3018December 3018December 3018defeated
National Identity Card (NIC) ActNovember 3018December 3018defeated
Eminent Domain ActMay 3018November 3018defeated
Cabinet Proposal of April 3017April 3017April 3017defeated
Extension of the Legislative and Executive Term 3017March 3017March 3017defeated
Break the Power of the UsurersAugust 3015August 3015passed
Liberties Bill of CSDPJuly 3008November 3008defeated
Free Contraceptives BillMay 3003May 3003defeated
National and Communal Banking BillMay 3003May 3003defeated
Encouraging DWCs BillMay 3003May 3003defeated
New Adoption Policy BillMay 3003May 3003defeated
Right to Privacy BillMay 3003May 3003passed
Localised Testing Policies BillMarch 3003March 3003defeated
National and Private Defence Industry BillMarch 3003March 3003defeated

Random fact: Party candidates for head of state elections are not visible to the public. This means that you cannot see who will run and who will not, which adds another strategic element to the elections.

Random quote: "I worked at a factory owned by Germans, at coal pits owned by Frenchmen, and at a chemical plant owned by Belgians. There I discovered something about capitalists. They are all alike, whatever the nationality. All they wanted from me was the most work for the least money that kept me alive. So I became a communist." - Nikita Khrushchev

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51