Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5575
Next month in: 00:32:32
Server time: 15:27:27, November 28, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Kundrati Workers Party[?]

This page contains information about the Kundrati Workers Party.

This party is inactive.

Details

User[?]: scottish_12

Nation[?]: Kundrati Union (Kundrati)

Seats[?] in Legebiltzarra/Národná rada (National Legislature)[?]: 0

Color[?]:

 

Description[?]:

Kundrati Workers Party (KWP)

Party Chairman: Ena Burja
Governing Body: KWP National Committee
National Assembly Leader: Lucas Brumec
Founders: Mitar Kladnik, Jakov Jelen, Ena Burja
Founded: 5233
Students Wing: College Workers of Kundrati
Youth Wing: Young Workers of Kundrati
Women’s Wing: National Federation of Kundrati Working Women
LGBTQ+ Wing: LGBTQ Workers of Kundrati
Ideologies:
Majority: Modern liberalism
Factions: Centrism, Progressivism, Social Democracy

Upon foundation, the KWP supported agrarianism, representing farmers and rural interests. More recently, the party began to favor more liberal positions (the term "liberal" in this sense describes modern liberalism, rather than classical liberalism or economic liberalism). Historically, the party has represented farmers, laborers, and religious and ethnic minorities as it has opposed unregulated business and finance and favored progressive income taxes. In foreign policy, internationalism (including interventionism) was a dominant theme. The party advocates for social programs targeted at the poor. The major influences for liberalism were labour unions and Ethnic minorities. Environmentalism has been a major component also. The Party is predominantly a coalition of centrists, liberals, and progressives, with significant overlap between the three groups. Political scientists characterize the KWP as less ideologically cohesive than other parties due to the broader diversity of coalitions that compose the KWP.

Current High Ranking KWP Officials

Lucas Brumnec (b.5197), Leader of the KWP in the National Assembly 5246-, MNA for Celania 5243-

Ena Burja (b. 5199), one of the three founders of the KWP, Party Chairman 5246-, President of Kundrati 5248-, Minister of Foreign Affairs 5243-5246, MNA for Jildrath 5238-

Mario Perme (b.5174), Minister of Finance 5246-5248, MNA for Peghonia 5238-

Valent Verdnik (b.5214), Minister of Infrastructure and Transport 5246-5248, MNA for Pilgon 5238-

Fatima Remic (b.5223), Minister of Environment and Tourism 5246-5248, MNA for Pilgon 5238-

Manfred Majcen (b. 5182), Minister of Justice 5243-5246, MNA for Jildrath 5238-

Selena Podlesnik (b. 5177), Minister of Food & Agriculture 5243-4246, MNA for Jildrath 5238-

Pamela Rijavec (b. 5211), Governor of Peghonai 5238-5243 & 5248-


Former High Ranking KWP Officials

Mitar Kladnik (b.5200, d. 5246), one of the three founders of the KWP, Party Chairman 5233-5246. He was killed when a bomb exploded near his position while he was defending the city of Venora in Celania from the advancing Junta during the Kundrati Conflict. MNA for Peghonai 5238-5246.

Petar Gregorc (b.5203, d.5245), former KWP Minister for Trade and Industry 5243-5245. He was arrested and murdered during the Kundrati Conflict. MNA for Peghonai 5238-5245.

Jakov Jelen (b. 5195, d.5246), one of the three founders of the KWP, Leader of the KWP in the National Assembly 5233-5246. MNA for Peghonai 5238-5246.


Political Positions

Economic policy
Expand Social Security and safety net programs.
Increase the capital gains tax rate to 39.6% for taxpayers with annual income above $1 million.
Cut taxes for the working and middle classes as well as small businesses.
Change tax rules to discourage shipping jobs overseas.
Increase federal and state minimum wages.
Modernize and expand access to public education and provide universal preschool education.
Support the goal of universal health care.
Increase investments in infrastructure development as well as scientific and technological research.
Offer tax credits to make clean energy more accessible for consumers and increase domestic production of clean energy.
Uphold labor protections and the right to unionize.
Reform the student loan system and allow for refinancing student loans.
Make college more affordable.
Mandate equal pay for equal work regardless of gender, race, or ethnicity.

Social policy
Decriminalize or legalize marijuana.
Uphold network neutrality.
Implement campaign finance reform.
Uphold voting rights and easy access to voting.
Support same-sex marriage and ban conversion therapy.
Allow legal access to abortions and women's reproductive health care.
Reform the immigration system and allow for a pathway to citizenship.
Expand background checks and reduce access to assault weapons to address gun violence.
Improve privacy laws and curtail government surveillance.
Oppose torture.
Abolish capital punishment.
Recognize and defend Internet freedom worldwide.


Economic issues

Equal economic opportunity, a social safety net, and strong labor unions have historically been at the heart of KWP economic policy. The KWP economic policy positions tend to align with those of middle and working class. The KWP supports a progressive tax system, higher minimum wages, Social Security, universal health care, public education, and subsidized housing. They also support infrastructure development and clean energy investments to achieve economic development and job creation. The party has at times supported centrist economic reforms that cut the size of government and reduced market regulations. The party has generally rejected both laissez-faire economics and market socialism, instead favoring Keynesian economics within a capitalist market-based system.

Fiscal policy
The KWP supports a more progressive tax structure to provide more services and reduce economic inequality by making sure that the wealthiest Kundratians pay more in taxes. They oppose the cutting of social services, such as Social Security, believing it to be harmful to efficiency and social justice. The KWP believe the benefits of social services in monetary and non-monetary terms are a more productive labor force and cultured population and believe that the benefits of this are greater than any benefits that could be derived from lower taxes, especially on top earners, or cuts to social services. Furthermore, the KWP see social services as essential toward providing positive freedom, freedom derived from economic opportunity.

Minimum wage
The KWP favors raising the minimum wage.

Health Care
The KWP calls for "affordable and quality health care" and favor moving toward universal health care in a variety of forms to address rising healthcare costs. Progressive KWP politicians favor a single-payer program, while liberals prefer creating a public health insurance option.

Education
The KWP favors improving public education by raising school standards. They also support universal preschool and expanding access to primary education, including through charter schools. They call for addressing student loan debt and reforms to reduce college tuition. Other proposals have included tuition-free public universities and reform of standardized testing. The KWP have the long-term aim of having publicly funded college education with low tuition fees, which would be available to every eligible Kundratian student. Alternatively, they encourage expanding access to post-secondary education by increasing state funding for student financial aid such as college tuition tax deductions.
Environment
The KWP believes that the government should protect the environment and have a history of environmentalism. In more recent years, this stance has emphasized renewable energy generation as the basis for an improved economy, greater national security, and general environmental benefits. The KWP is substantially more likely than other Kundrati parties to support environmental regulation and policies that are supportive of renewable energy. The KWP also favors expansion of conservation lands and encourages open space and rail travel to relieve highway and airport congestion and improve air quality and the economy as it "believes that communities, environmental interests, and the government should work together to protect resources while ensuring the vitality of local economies. Once Kundratians were led to believe they had to make a choice between the economy and the environment. They now know this is a false choice". The foremost environmental concern of the Kundrati Workers Party is climate change and has pressed for stern regulation of greenhouse gases.

Renewable energy and fossil fuels
The KWP have supported increased domestic renewable energy development, including wind and solar power farms, in an effort to reduce carbon pollution. The party's platform calls for an "all of the above" energy policy including clean energy, natural gas and domestic oil, with the desire to become energy independent. The party has supported higher taxes on oil companies and increased regulations on coal power plants, favoring a policy of reducing long-term reliance on fossil fuels. Additionally, the party supports stricter fuel emissions standards to prevent air pollution.

Trade agreements
Many members of the KWP support fair trade policies when it comes to the issue of international trade agreements and some in the party have started supporting free trade in recent years.


Social Issues

The modern Kundrati Workers Party emphasizes social equality and equal opportunity. The KWP supports voting rights and minority rights, including LGBT rights. Ideological social elements in the party include cultural liberalism, civil libertarianism, and feminism. Some KWP social policies are immigration reform, electoral reform, and women's reproductive rights.

Equal opportunity
The KWP supports equal opportunity for all Kundarians regardless of sex, age, race, ethnicity, sexual orientation, gender identity, religion, creed, or national origin. Many members of the KWP support affirmative action programs to further this goal.

Voting rights
The party is very supportive of improving voting rights as well as election accuracy and accessibility. They support extensions of voting time, including making election day a holiday. They support reforming the electoral system to eliminate gerrymandering, as well as passing comprehensive campaign finance reform.

Abortion and reproductive rights
The KWP believes that all women should have access to birth control and supports public funding of contraception for poor women. In its recent National Conferences, the KWP has called for abortion to be "safe, legal and rare"—namely, keeping it legal by rejecting laws that allow governmental interference in abortion decisions and reducing the number of abortions by promoting both knowledge of reproduction and contraception and incentives for adoption. As a matter of the right to privacy and of gender equality, many members of the KWP believe all women should have the ability to choose to abort without governmental interference. They believe that each woman, conferring with her conscience, has the right to choose for herself whether abortion is morally correct. Groups such as Kundrati Workers for Life of Kundrati represent the anti-abortion faction of the party. According to the most recent KWP National Conference, "The KWP believe every woman should be able to access high-quality reproductive health care services, including safe and legal abortion."

Immigration
Many KWP politicians have called for systematic reform of the immigration system such that residents that have come into Kundrati illegally have a pathway to legal citizenship.

LGBT rights
The KWP is supportive of LGBT rights and supports Gay marriage.


Legal issues

Death penalty
The KWP currently opposes the death penalty.

Torture
Many members of the KWP are opposed to the use of torture against individuals apprehended and held prisoner by the Kundrati military. Members of the KWP contend that torture is inhumane, damages Kundratis moral standing in the world, and produces questionable results. The KWP are largely against waterboarding.

Privacy
The Democratic Party believes that individuals should have a right to privacy. Some members of the KWP have championed consumer protection laws that limit the sharing of consumer data between corporations and many members of the KWP believe that government should not regulate consensual noncommercial sexual conduct among adults as a matter of personal privacy.


Members of the National Assembly (MNAs)

Total: 97

Celania: 26
Lucas Brumnec 5243-
Natali Novakoviæ 5243-
Hugo Gaènik 5243-
Tjaš Èuèek 5243-
Mehmed Kolar 5243-
Ambrož Mozetiè 5243-
Marinko Grošelj 5243-
Besim Prašnikar 5243-
Rexhep Nemaniè 5243-
Marijan Bratina 5243-
Erik Petelin 5243-
Herman Bitenc 5243-
Saško Beganoviæ 5243-
Hanka Bajc 5243-
Nea Benedièiè 5243-
Elma Bogataj 5243-
Marija Magdalena Jarc 5243-
Angelina Majeriè 5243-
Davorka Škufca 5248-
Samira Završnik 5248-
Gaia Jerebic 5248-
Lela Hafner 5248-
Risto Lazar 5248-
Leopold Meško 5248-
Mujaga Kosmaè 5248-
Meho Mihevc 5248-

Jildrath: 7
Ena Burja 5238-
Manfred Majcen 5238-
Selena Podlesnik 5238-
Tom Klemenc 5238-
Gabriel Krajnik 5238-
Fadil Nemec 5238-
Ante Lipovšek 5238-

Pilgon: 12
Nej Glavan 5238-
Valent Verdnik 5238-
Fatima Remic 5238-
Antonija Matiæ 5238-
Roža Kobal 5238-
Ksenja Gruden 5238-
Barbara Sodja 5238-
Samuel Simoniè 5238-
Mersudin Matiæ 5238-
Jan Guèek 5238-
Arsen Veseliè 5243-
Zorko Kranjec 5243-

Lirnak: 15
Ian Ciglar 5238-
Vanessa Gros 5238-
Amra Kristan 5238-
Mladen Pšeniènik 5238-
Valter Urbanija 5238-
Angel Markelj 5238-
Pavle Kosec 5238-
Marsel Plevnik 5238-
Mirsad Torkar 5238-
Nedim Markiè 5243-
Mehmed Gril 5243-
Chiara Fišer 5243-
Gaia Peèar 5243-
Rajka Klanènik 5243-
Jana Pavliè 5243-

Peghonai: 37
Mitar Kladnik 5238-5246
Jakov Jelen 5238-5246
Petar Gregorc 5238-5246
Mario Perme 5238-
Ota Petroviè 5238-
Smiljana Vogrinec 5238-
Ðurða Rejc 5238-
Šarika Grašiè 5238-
Patricia Božiæ 5238-
Boja Zorko 5238-
Zofka Èarman 5238-
Alekseja Bogataj 5238-
Franja Kos 5238-
Nasiha Rutar 5238-
Isabella Lesjak 5238-
Rupert Šeruga 5238-
Jožef Križnar 5238-
Bogdan Nemaniè 5243-
Miran Pirih 5243-
Radivoj Jež 5243-
Avguštin Peènik 5243-
Voranc Jeriè 5243-
Jožef Mahniè 5248-
Alban Cvikl 5248-
Gregor Trobec 5248-
Suljo Stankoviæ 5248-
Tobias Kumer 5248-
Petar Bauman 5248-
Marijo Florjanèiè 5248-
Ladislav Pajk 5248-
Novo Štemberger 5248-
Stipo Gril 5248-
Janina Oèko 5248-
Nadia Baloh 5248-
Nadja Prah 5248-
Slavojka Plavèak 5248-
Dagmar Urh 5248-

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsmoderate permissiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistclose to noneperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketconvinced regulatorexcellentperfect
Militarymoderate militaristhighperfect
Moralitymoderate progressivehighperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 523334,09665,020,3710.05+0.0504500.00+0
February 523810,348,31662,499,44616.56+16.517645016.89+76
February 524311,436,77964,531,13817.72+1.178045017.78+4
February 524812,623,28961,566,55620.50+2.789747020.64+17

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Kundrati Workers Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347

BillCreatedVoting startedVoteBill StatusResult
Initial Positioning With Zero Chance Of Passing ActJanuary 2315January 2315passed
Kundrati Education Act, Part V: Higher EducationJanuary 2314January 2314passed
Market Deregulation ActNovember 2313November 2314passed
Kundrati Education Act, Part III: Private EducationOctober 2313January 2314defeated
Kundrati Education Act, Part II: DisciplineOctober 2313January 2314passed
Kundrati Education Act, Part I: SegregationOctober 2313January 2314defeated
Internet Domain ActAugust 2313February 2314passed
Kundrati Education Act, Part IV: All The RestMay 2313January 2314passed
Bills We Missed ActMay 2313October 2313passed
Ban on Military Exports BillJanuary 2313February 2313defeated
Banning of Private schoolsOctober 2312November 2312defeated
Solar System DraftNovember 2311December 2311defeated
Military BillNovember 2311December 2311passed
Energy Regulation BillMay 2311December 2311defeated
Adoption ActDecember 2310November 2311defeated
Secular Kundrati ActAugust 2310March 2311passed
Decentralized Smoking ActNovember 2309May 2310passed
Abortion ResolutionNovember 2309May 2310passed
Local Stewardship ActOctober 2309March 2311passed
Privatization of EducationFebruary 2309July 2309defeated

Random fact: There is a phpBB forum dedicated to Particracy. Please click the Forum link in the top game menu. Additions to the game, suggestions and discussion is held there so get involved. http://forum.particracy.net/

Random quote: "Blah blah blah- I'm more of a Leftist than all you puppets... You support cops beating people down and kicking out all the foreigners..." - Omar al-Khali, former Kalistani politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51