Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5495
Next month in: 01:15:32
Server time: 22:44:27, June 06, 2024 CET
Currently online (2): botangabrielkizenia | SE33 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


✊Independent Workers Party[?]

This page contains information about the ✊Independent Workers Party.

This party is inactive.

Details

User[?]: Independent Humanitarian Party

Nation[?]: Royaume Uni de Lourenne (Lourenne)

Seats[?] in Assembleé Royale (Royal Assembly)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsmoderate permissiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistmoderateperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate laissez-fairehighperfect
Militaryconvinced militaristhighperfect
Moralityconservative-leaningmoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 419224,775,02229,758,04683.25+83.2520225080.80+202

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the ✊Independent Workers Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321

BillCreatedVoting startedVoteBill StatusResult
The No First Use ActJuly 2459July 2459defeated
Call for early elections, July 2459July 2459July 2459defeated
Decentralization Act of 2459February 2459January 2461passed
Free Confederate Republics of LourenneFebruary 2459January 2461defeated
The No Killing Other People With Second Hand Smoke ActFebruary 2459February 2459defeated
The Recycling ActFebruary 2459February 2459defeated
The Gift of Life ActFebruary 2459February 2459defeated
The Health Care for All ActFebruary 2459February 2459defeated
The Prevention of Egregious Abuse of Animals ActFebruary 2459February 2459defeated
The No Proselytizing to Children ActFebruary 2459February 2459passed
The Free Trade ActFebruary 2459February 2459defeated
The Beacon of Freedom ActFebruary 2459February 2459defeated
Marriage Freedom ActFebruary 2459February 2459defeated
Farm Size ReformFebruary 2459February 2459passed
Protection of Endangered SpeciesOctober 2458February 2459defeated
Our National AnthemMarch 2458March 2458passed
Food Regulation DecentralizationFebruary 2458March 2458passed
Gated CommunitiesFebruary 2458February 2458passed
Local Fire DepartmentsFebruary 2458February 2458passed
Eminent Domain CompensationFebruary 2458February 2458passed

Random fact: In Particracy players are only allowed to play as one party at a time. Want to swap nations? Inactivate your current party and make a new one! Want to return? Request Moderation to reactivate your party on the forum!

Random quote: "Democracy is more dangerous than fire. Fire can't vote itself immune to water." - Michael Z. Williamson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51