Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: March 5498
Next month in: 00:43:33
Server time: 03:16:26, June 13, 2024 CET
Currently online (1): dnobb | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Progress Party[?]

This page contains information about the Progress Party.

This party is inactive.

Details

User[?]: BenBen90

Nation[?]: Dewleta nû ya Barmenia (Barmenistan)

Seats[?] in Meclîsa Gel (Assembly of the People)[?]: 0

Color[?]:

 

Description[?]:

The Progress Party of Barmenia(fmr. Conervative Progress party, Republican Patriotic Progress Party), was founded in 2468.
At the time it was called The Radical Right Conservative Movement for lower taxes and less Immigration. the name changed in 2471.The first leader of he Radical Right Conservative Movement for lower taxes and less Immigration was Jemela Thut'mjadojshal.

Positions:

We are PRO:
BANNING COMMUNISM
Guns
Life
National Military
Private Health care(HMO's)
Public School but no regulation on the private
Privatized Industry in every other Area
Law and Order
Protection and defense
Business and Corporations etc


We are AGAINST:
Gun Control
Communist, Marxist, Socialist, Social-Democratic Ideas etc.
Government Welfare
Same-Sex Marriage
Socialized Medicine(Public Health Care)
Abortion
Environment Hysteria and "Global Warming"


This is what the RSP stands for:

1. Civil Liberties to be abolished by letting Brn Jezstad decide everything for you and about you 24/7.
2. Nationalisation of all industries so that they can drag the people into a socialist experiment.
3. Protection of trade Unions rights to create a
development of a unstable, slow soviet economy
5. Destroy national security and let others(including the terrorists) rule our homeland.Also called "SISSY POLICY."
6. A strong central Government for destruction of induvidual rights, and let the gov. decide for you about everything, less induvidual freedom.





Trouble with political positions
These are the real ones:
Centralization : federalist-leaning
Civil Rights :permissive-leaning
Ecology : Convinced skeptic
Foreign Relations :isolationist-leaning
Government Responsibilities:Big-government leaning
Market moderate : larriez-faire
Military :militarist-leaning
Morality :moderate conservative
Religion :moderate secular




Score on the "Moral politics" quiz;

PROGRESS PARTY'S SCORE

Your scored 7 on Moral Order and -7 on Moral Rules.

The following categories best match your score (multiple responses are possible):

1. System: Conservatism
2. Ideology: Conservative Neo-Conservatism Fundamentalism, Ultra Capitalism
3. Party: Republican Party, Constitution Party
4. Presidents: George W. Bush
5. 04' Election: Michael Peroutka
6. 08' Election: Fred Thompson



Of the 440,999 respondents (3,826 on Facebook):

1. 2% are close to you.
2. 0% are more conservative.
3. 1% are more liberal.
4. 95% are more socialist.
5. 0% are more authoritarian.

PP's Score on the Political Ideology quiz:


Political Ideology Quiz
You scored as a Republican
You're a Republican. How dull.
Republican
100%
Libertarian
82%
Fascist
49%
Anarchism
42%
Democrat-
3%
Socialism
1%

The Republican Socialist Party was a Democratic party.
We need them. Communism is NOT RIGHT FOR BARMENIA.


In 2604, the party changed it's name to the Conservative Progress Party.
The party became inactive, but John Hanock jr. re-established the party.
It's Current name is The Republican Progress party.

A long inactive period followed, but James Woodson reestablished it as The Republican Progress and Anti-Communist Conservative Party.


It later that month changed name back.

In September 2697 it changed its name to the Republican Patriotic Progress Party(of the United Barmenian Democratic States) as a protest against the flag change.

http://images.wikia.com/particracy/images/1/14/Barmenistan_flag_2357.png
http://images.wikia.com/particracy/images/1/14/Barmenistan_flag_2357.png
http://images.wikia.com/particracy/images/1/14/Barmenistan_flag_2357.png

http://www.navyband.navy.mil/anthems/ANTHEMS/Virgin%20Islands.mp3
http://www.navyband.navy.mil/anthems/ANTHEMS/Virgin%20Islands.mp3
http://www.navyband.navy.mil/anthems/ANTHEMS/Virgin%20Islands.mp3



THE OLDEST PARTY IN BARMENIA!!!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate small governmenthighperfect
Marketmoderate regulatorhighperfect
Militarymoderate militaristclose to noneperfect
Moralityconservative-leaningexcellentperfect
Religionsecular-leaningexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 246838,89992,044,2620.04+0.0402130.00+0
December 247158,17592,286,6100.06+0.0202130.00+0
December 24796,623,98287,930,4937.53+7.47324257.53+32
February 24819,380,05587,067,87810.77+3.244542510.59+13
October 248415,554,54194,702,89316.42+5.657142516.71+26
September 248712,503,55992,016,75913.59-2.845842513.65-13
August 249021,159,85289,909,43123.53+9.9510242524.00+44
July 249317,031,34691,635,50718.59-4.958042518.82-22
June 249618,221,30091,799,63219.85+1.268442519.76+4
May 249921,151,76196,083,42722.01+2.169542522.35+11
April 250217,815,63795,505,22418.65-3.363820019.00-57
March 25057,391,75892,335,5078.01-10.65142007.00-24
April 250811,670,35186,280,72013.53+5.524030013.33+26
May 25119,633,64293,767,40510.27-3.253130010.33-9
June 251417,040,08694,993,00517.94+7.665530018.33+24
July 251725,602,07793,490,92527.38+9.458530028.33+30
August 252025,011,95695,257,67326.26-1.138130027.00-4
September 252323,785,66793,566,25025.42-0.848030026.67-1
October 252629,348,05894,590,45631.03+5.619730032.33+17
November 252924,484,98297,420,81025.13-5.897830026.00-19
December 253224,977,54497,867,09325.52+0.397930026.33+1
January 253626,422,70897,450,61027.11+1.598130027.00+2
February 253930,425,124108,657,60028.00+0.898530028.33+4
March 254230,549,023102,156,16729.90+1.909130030.33+6
April 254525,284,545100,334,29325.20-4.707630025.33-15
May 254834,443,461103,094,50133.41+8.2110230034.00+26
June 255136,492,732111,788,18632.64-0.779830032.67-4
July 255431,671,509101,117,49231.32-1.329430031.33-4
August 255733,545,915110,448,56730.37-0.959430031.33+0
September 256021,586,732106,241,88420.32-10.056130020.33-33
October 256324,976,258115,403,28721.64+1.326730022.33+6
November 256618,778,479119,576,84215.70-5.944530015.00-22
December 256915,495,059113,909,20013.60-2.104130013.67-4
December 257212,537,817118,871,08510.55-3.063130010.33-10
December 257521,666,931119,121,04118.19+7.645530018.33+24
December 257818,408,935121,687,78415.13-3.064530015.00-10
December 258119,288,000118,943,45216.22+1.094930016.33+4
December 258422,927,617121,816,35018.82+2.615530018.33+6
December 258724,658,728125,585,81119.63+0.815930019.67+4
December 259021,051,706128,885,27016.33-3.304930016.33-10
December 259319,892,799132,802,92314.98-1.354530015.00-4
December 259621,621,769127,960,76716.90+1.925130017.00+6
December 259921,361,404125,924,98716.96+0.075130017.00+0
December 260226,987,168136,350,63719.79+2.836030020.00+9
December 260518,473,441136,135,89713.57-6.224030013.33-20
December 260813,531,098131,890,37410.26-3.313030010.00-10
December 261119,400,311130,748,65114.84+4.584430014.67+14
December 261411,919,667136,419,2468.74-6.10253008.33-19
December 261718,459,308129,444,87314.26+5.524330014.33+18
December 262017,134,923133,709,17912.82-1.453830012.67-5
December 262322,609,173144,654,26815.63+2.814730015.67+9
December 262620,891,804140,732,82614.85-0.784430014.67-3
December 262924,484,190135,966,31918.01+3.165430018.00+10
December 263225,968,235133,795,28219.41+1.405830019.33+4
December 263536,117,629129,638,99427.86+8.458230027.33+24
December 263836,138,568130,357,78627.72-0.148330027.67+1
December 264141,328,964147,238,55328.07+0.358330027.67+0
July 264366,591,280151,346,78744.00+15.9313130043.67+48
October 264767,033,896144,479,43646.40+2.4013830046.00+7
October 265051,998,384115,993,77944.83-1.5713430044.67-4
October 265351,339,115111,193,69746.17+1.3413830046.00+4
February 270290,781,530170,353,42853.29+7.1218635053.14+48
February 270874,511,934139,956,69653.24-0.0518735053.43+1
September 271349,425,504160,994,89730.70-22.546220031.00-125
August 271538,129,881175,170,54121.77-8.934420022.00-18
March 271720,627,026181,711,41311.35-10.426557711.27+21

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Progress Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360

BillCreatedVoting startedVoteBill StatusResult
Balanced Budget ActApril 2249April 2249passed
Universal Preschool ActApril 2249April 2249passed
Higher Education Opportunity Expansion Act IIApril 2249April 2249passed
Higher Education Opportunity Expansion ActJanuary 2249January 2249passed
National Energy Act IIJanuary 2249January 2249passed
Public Broadcasting ActNovember 2248November 2248passed
Foreign Relations BillOctober 2248July 2249defeated
Eminent Domain ActJuly 2248July 2248passed
Corporate Tax Fairness ActJuly 2248July 2248defeated
National Energy ActMay 2248May 2248passed
Democratic Workers Council Support ActApril 2248April 2248defeated
The "Fixing All The Stuff The Capitalist Bastards Screwed Up" Act Part 11April 2248April 2248passed
The "Fixing All The Stuff The Capitalist Bastards Screwed Up" Act Part 10April 2248April 2248passed
The "Fixing All The Stuff The Capitalist Bastards Screwed Up" Act Part 9April 2248April 2248passed
Budget proposal of April 2248April 2248April 2248passed
Progressive Taxation PolicyApril 2248April 2248passed
People's Cabinet of 2237November 2247November 2247passed
The "Fixing All The Stuff The Capitalist Bastards Screwed Up" Act Part 8November 2247November 2247passed
The "Fixing All The Stuff The Capitalist Bastards Screwed Up" Act Part 7October 2247October 2247passed
The "Fixing All The Stuff The Capitalist Bastards Screwed Up" Act Part 6October 2247October 2247passed

Random fact: Use a valid e-mail address for your Particracy account. If the e-mail address you entered does not exist, your account may be suspected of multi-accounting and inactivated.

Random quote: "Who are the militia? Are they not ourselves? Is it feared, then, that we shall turn our arms each man gainst his own bosom. Congress have no power to disarm the militia. Their swords, and every other terrible implement of the soldier, are the birthright of an American...[T]he unlimited power of the sword is not in the hands of either the federal or state governments, but, where I trust in God it will ever remain, in the hands of the people." - Tenche Coxe

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51