Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5497
Next month in: 01:54:43
Server time: 18:05:16, June 11, 2024 CET
Currently online (2): Mbites2 | Tayes_Gad | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


The Ultimate Freedoms Party[?]

This page contains information about the The Ultimate Freedoms Party.

This party is inactive.

Details

User[?]: The Real Luquado

Nation[?]: Pontesi Hanrapetut’yun (Pontesi)

Seats[?] in Պոնտեսիայի Ազգային ժողով (National Assembly of Pontesi)[?]: 0

Color[?]:

 

Description[?]:

This party stands for the rights of the people to engage in any behavior they wish. Short of hurting or killling another human being, we believe that men and women should be free to do whatever they wish in all aspects of life. In that regards, we believe the government should be there for the sole purpose of basic civil order and defense.

We Are Against any Law or Legislation that restricts the rights of the people of Pontesi in any way whatsoever.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketregulator-leaninghighperfect
Militarypacifist-leaningclose to noneperfect
Moralityconvinced progressivelimitedperfect
Religionsecular-leaninghighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 244152,02474,963,8270.07+0.0706250.00+0
May 24447,738,17080,412,3349.62+9.55606259.60+60
June 24465,563,19778,726,9037.07-2.56426256.72-18

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the The Ultimate Freedoms Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330

BillCreatedVoting startedVoteBill StatusResult
Free Trade ActFebruary 2159August 2159passed
Cabinet Proposal of October 2158October 2158October 2158passed
Child Support Devolution ActJanuary 2158August 2159passed
Green BillJanuary 2158January 2158passed
Union Busting BillJanuary 2158January 2158defeated
Budget proposal of December 2157December 2157February 2158passed
Capital Punishment BillSeptember 2157August 2159defeated
Aid BillSeptember 2157January 2158passed
Protectionist BillSeptember 2157January 2158passed
Capital City ActSeptember 2157September 2157passed
Identity Cards BillAugust 2157August 2159passed
Anti-Prostitution ActAugust 2157November 2158passed
More FederalismAugust 2157November 2158passed
Civil Defence BillAugust 2157January 2158passed
Eminent Domain BillAugust 2157January 2158passed
Nuclear Energy BillAugust 2157January 2158passed
Jobseekers Allowance BillAugust 2157January 2158passed
Civil Liberties Act 2157August 2157September 2157passed
Ratification of the Global Emancipation TreatyAugust 2157September 2157defeated
Ratification of the Barmenistan Free Trade AgreementAugust 2157September 2157defeated

Random fact: Particracy isn't just a game, it also has a forum, where players meet up to discuss role-playing, talk about in-game stuff, run their own newspaper or organisation and even discuss non-game and real-life issues! Check it out: http://forum.particracy.net/

Random quote: "Communism: liberation of the people from the burdens of liberty." - Rick Bayan

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51