Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5500
Next month in: 02:11:53
Server time: 09:48:06, June 18, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Populaire Marxist Front[?]

This page contains information about the Populaire Marxist Front.

This party is inactive.

Details

User[?]: aliz_com

Nation[?]: Union of Rildanor (Rildanor)

Seats[?] in Conseil de l'État Rildanorien (Council of the Rildanorian State)[?]: 0

Color[?]:

 

Description[?]:

We are the Populaire Marxist Front, We are reformation to the social system in our country. We believe in a diverse society ethnically mixed and culutrally diffrent. We want to base the country on a newlly reformated Socialist System. On the tradition belief of Karl Marx.

So Where Do We Stand?

Foreign Affairs: We believe that we should unite will all our socialist/communist comrades.

Immigration: We are Pro-immigration for all types of people regardless of color of skin or religion.

Religion: We personally believe that religion can be practiced but ourselfs are seen as secularist, We still hold the Secular though as Karl Marx did.

Military: We are pro-military for the sake of a socialist/communist revoultion in the sake of socialism, we believe to fight in for socialism in all costs.

Finance: We help all our citizens with our new socialist system.

What are we against? Were Anti, Fascism,Rascism,,Extreme Religion and Explotion of Peoples Rights.

What are we pro? We support The Socialist/Communist System,Workers Rights,Unity and Socialist Freedom.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketmoderate laissez-fairehighperfect
Militaryunknownclose to noneperfect
Moralityconservative-leaningmoderateperfect
Religionmoderate religiouslimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 245742,18486,133,3880.05+0.0501500.00+0
August 246038,91190,959,7050.04-0.0101500.00+0
August 246347,73390,448,6410.05+0.0102500.00+0
August 246641,39792,228,1380.04-0.0102500.00+0
August 246944,59092,484,1290.05+0.0002500.00+0
August 24724,349,76091,869,9184.73+4.69102504.00+10

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Populaire Marxist Front.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458

BillCreatedVoting startedVoteBill StatusResult
Acte De Conservation De FauneJanuary 2444December 2444passed
Acte de NormalizationJanuary 2444June 2444passed
Acte Front Populaire sur l'EconomieJanuary 2444January 2444defeated
Cabinet Progressif Tout-GaucheJanuary 2443January 2444passed
Manifeste Mai 1erMay 2442June 2444defeated
Élections TôtMay 2442May 2442passed
Acte pour les droits personnelles de corps de Avril 2442April 2442February 2443defeated
Acte pour la libéralisation de auto-défense personnelle de Avril 2442April 2442February 2443defeated
Acte pour Déréglementation des Cartes d'Identification de Avril 2442April 2442February 2443defeated
Acte pour les droits de les Ouvrieurs (ou Ouvrieuses) de Sexe de Avril 2442April 2442February 2443defeated
Société Nationale des Chemins de Fer Rildanoryane (SNCR)April 2442January 2443passed
Loi Pharmaceutique Personnelle De Responsabilité (PPRA)April 2442November 2442defeated
Cabinet Proposal of April 2442April 2442April 2442defeated
Extension des liberies personnels de nos personnesJune 2441November 2442defeated
EMERGENCY DEBATE: Mordusian Military Support, 2441June 2441November 2442passed
Domaine d'Internet et site Web de gouvernement - Internet Domain and Government Website, 2441June 2441November 2442passed
Un Meilleur Monde est Possible!June 2441June 2441defeated
Manifeste Électoral de FNR - Défense et SécuritéApril 2441June 2441defeated
Manifeste Électoral de FNR - ÉcologieApril 2441June 2441defeated
Manifeste Électoral de FNR - Société et Libertés CivilesApril 2441June 2441defeated

Random fact: The voters enjoy active parties who take upon themselves the initiative to create laws.

Random quote: "If we don't believe in freedom of expression for people we despise, we don't believe in it at all." - Noam Chomsky

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51