Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5575
Next month in: 02:14:49
Server time: 17:45:10, November 28, 2024 CET
Currently online (2): ImportantGuy | JourneyKan | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Symmahia Kalopaion[?]

This page contains information about the Symmahia Kalopaion.

This party is inactive.

Details

User[?]: ermis

Nation[?]: Kalopikí Dimokratía (Kalopia)

Seats[?] in Κοινοβούλιο - Parliament[?]: 0

Color[?]:

 

Description[?]:

Symmahia Kalopaion is a massive, social democratic and ecologist party in Kalopia. Its roots can be found in the remnants of the old leftist Dimokratikos Synaspismos, DISY etc. A lot of politicians, after DISY dissolved, formed a similar party, under the leadership of Alexandros Antonopoulos, nephew of a former leader. Symmahia Kalopaion seeks to include in its groups, every Kalopian citizen, regardless of political views. In Symmahia, a lot of politicians coming from traditional liberalism, centrism or even popular right, have crucial positions in the party hierarchy.

Our party has over 820,000 members by now, and an estimated number of 25-30 offices all over the country.

President: Alexandros Antonopoulos
VicePresident: Panagiotis Kalidis
General Secretary of Cent. Comittee: Thomas Kourtidis
President of Symmahia YOUTH: Nikolas Mpalomenos
President of Symmahia UNIVERSITIES: Aggeliki Dimitriou
Party Spokesperson: Vasiliki Mitra

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistmoderateperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketmoderate regulatorhighperfect
Militaryconvinced militaristmoderateperfect
Moralityconvinced progressivehighperfect
Religionmoderate secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 479848,27163,513,7250.08+0.0803000.00+0
December 479914,054,12361,345,66022.91+22.836630022.00+66
June 480319,263,66559,697,81532.27+9.369630032.00+30
June 480719,276,71559,989,50432.13-0.149630032.00+0
May 480916,541,14355,218,70529.96-2.189030030.00-6
May 481315,194,79254,968,36227.64-2.318230027.33-8
August 481317,356,39749,676,91934.94+7.3010430034.67+22
August 481716,845,02349,194,82734.24-0.7010330034.33-1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Symmahia Kalopaion.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358

BillCreatedVoting startedVoteBill StatusResult
Welcome to Marlborou Country...April 2151April 2151passed
Cabinet Proposal of March 2151March 2151March 2151passed
Task Force DaggerJanuary 2151January 2151defeated
Tax free in the ChurchJanuary 2151January 2151defeated
What would Hoffa do...January 2151January 2151defeated
The nations security is in everyones interest!January 2151January 2151defeated
Infrastructure improvementsAugust 2150August 2150defeated
Signing the Kyoto protocollAugust 2150August 2150passed
The ABC education programAugust 2150August 2150defeated
Defence industriAugust 2150August 2150defeated
Tax from goods and servicesSeptember 2149September 2149defeated
Disicplinary grade in SchoolSeptember 2149September 2149defeated
Wantuni most leave its Fordist thinking!July 2149July 2149defeated
The Public Decency ActApril 2149April 2149defeated
The Fair Eminent Domain ActApril 2149April 2149passed
Treaty WithdrawalsApril 2149April 2149defeated
Legislative ActivityOctober 2147October 2147defeated
Increasing term lengthSeptember 2147September 2147passed
The Pesticides Protection ActDecember 2146December 2146passed
Trade Union ReformDecember 2146December 2146defeated

Random fact: Information about the population of each country can be found on the Population Information thread: http://forum.particracy.net/viewtopic.php?f=5&t=8663

Random quote: "Freedom is not worth having if it does not connote freedom to err." - Mahatma Gandhi

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51