Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5494
Next month in: 00:26:34
Server time: 07:33:25, June 06, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Interim National Democratic Congress[?]

This page contains information about the Interim National Democratic Congress.

This party is inactive.

Details

User[?]: Donrub

Nation[?]: Republika Deltarska (Deltaria)

Seats[?] in Kongres Poslanika/Congresul Deputaților (Congress of Deputies)[?]: 0

Color[?]:

 

Description[?]:

NOTE: The National Congress has held a major meeting with all the well-wishers of the nation who want that the minorities, needy and oppressed of the nation live with freedom.
We thus have temporarily formed the INTERIM NATIONAL DEMOCRATIC CONGRESS. This INDC will be headed by the National Congress party and will not rest till the nation rises from the centuries' of ignorance propagated by the Whig Party and the noveaux conservatives such as the DCP, PZP and the DBSM. We won't rest till the BILL OF RIGHTS is passed.

Long Live Free Deltaria! To A Free and Prosperous Deltaria!

Sir Roy Mathias
NC President
INDC Chairman

The party is centrist in ideology. The party was founded in 3361 by George Mathias. The party is a member and co-founder of the Deltarian Central Alliance. The party believes in meritocracy over democracy.

Party Founder: Dr. George Mathias

Party Presidium
Party President: Sir Roy Mathias
1st Vice President: Dr. Mark Feynman
2nd Vice President: James Berkley
+5 Vice Presidents
5 Regional Chairman

Secretariat of the Party Presidium
General Secretary: Karl Mathias
Deputy General Secretary: David Roque
10 National Secretaries
5 Regional Secretaries

All Deltaria National Congress
National Party Chairman: Dr. Mark Feynman
380 national branch representatives
2280 regional branch representatives
Total membership: 2660

5 Regional Congress'
5 Regional Chairman of the Party Presidium
5 Regional Secretaries of the Secretariat of the Party Presidium

5 Regional Directorates
5 General Deputies of the 5 Regional Directorates
Variable number of Regional Directors per region

Each Regional Congress
72 national branch representatives
432 regional branch representatives
Total membership: 504

The party's highest decision-making body is headed by the 29-member Presidium. The Presidium consists of the Party President, 7 Vice Presidents and 5 Regional Chairmen who are senior party leaders and a 16 member Party Secretariat. One of the members is also National Party Chairman.

The executive body of the Presidium is the Party Secretariat, which is headed by the General Secretary and consists of 10 National secretaries and 5 Regional Secretaries.

At the Regional level, every region has a Regional Chairman, Regional Secretary and a General Deputy, who heads a Regional Directorate.

The Party convenes Regional Congress' every 3 months and it convenes all Regional Congress' for a NATIONAL CONGRESS every 6 months.

IMPORTANT LEADERS

Prominent National Leaders
Dr. George Mathias, President of Deltaria (3421-3425)
Sir Roy Mathias, Premier of Deltaria (3406-3411) (3419-3422)
Karl Mathias, Dy Premier of Deltaria (3429-)

List of NC Presidents
Sir Dr. George Mathias (3361-3425); 61 yrs
Sir Roy Mathias (3425-)

List of NC General Secretaries
Sir Roy Mathias (3385-3425); 40 yrs
Karl Mathias (3425-)

List of NC Deputy General Secretaries
James Berkley (3385-3425); 40 yrs
Msgr David Roque (3425-)

List of NC Chairmen
Dr. George Mathias (3361-3385); 24 yrs
Dr. Mark Feynman (3385-)

List of Other Important NC Leaders
Dr. Mark Feynman - 1st Vice President (3361-3431)
James Berkley - 2nd Vice President (3425-)
Dr. Cyril Jameston - 2nd Vice President (3361-3425); 61 yrs

GOVERNMENT HISTORY

Formerly held Ministries:
3426- till date, 4th DCA Cabinet - Nicholas Hawthorn Cabinet
Ministry of Foreign Affairs: Karl Mathias
Ministry of Education and Culture: Dr. Cyril Jameston
Ministry of Trade and Industry: Msgr. David Roque

3422 - 3425, 3rd DCA & DCP, Whig Cabinet - Townsend Cabinet
Ministry of Internal Affairs: Karl Mathias
Ministry of Health and Social Services
Ministry of Trade & Industry: Jim Berkley

3419 - 3422, NC, DCP, Whig - Mathias II Cabinet
Head of Cabinet: Premier Sir Roy Mathias
Ministry of Foreign Affairs: Dr. George Mathias
Ministry of Infrastructure and Transport
Ministry of Health and Social Services
Ministry of Food and Agriculture

3411 - 3416, NC, RCP, DConsP, Whig - Poteat Cabinet
Ministry of Foreign Affairs: Sir Roy Mathias; Jim Berkley
Ministry of Education and Culture
Ministry of Environment and Tourism

3406 - 3411, NC, PAP, DConsP, LPPD - Mathias I Cabinet
Head of Cabinet: Premier Sir Roy Mathias
Ministry of Justice
Ministry of Infrastructure and Transport
Ministry of Education & Culture
Ministry of Science & Technology

3381 - 3382 , 1st DCA Cabinet
Ministry of Finance
Ministry of Defence
Ministry of Infrastructure and Transport
Ministry of Education and Culture
Ministry of Food and Agriculture

3370 - 3381, Socialist-1st DCA Cabinet
Ministry of Justice
Ministry of Education & Culture
Ministry of Science & Technology

Party info & article -http://particracy.wikia.com/wiki/National_Congress

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistmoderateperfect
Government Responsibilitiesmoderate small governmentmoderateperfect
Marketmoderate laissez-fairemoderateperfect
Militarymoderate pacifistlimitedperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 336127,51364,061,1010.04+0.0403330.00+0
May 33634,998,58659,883,6488.35+8.30303339.01+30
June 33646,562,42559,380,41311.05+2.703833311.41+8
May 33688,763,97762,869,93413.94+2.894633313.81+8
October 33697,577,85358,987,98312.85-1.094433313.21-2
October 33737,439,50355,680,76813.36+0.515138013.42+7
October 337714,322,85256,377,19025.41+12.049638025.26+45
October 33816,946,13962,355,89011.14-14.274138010.79-55
October 33856,298,05161,957,83010.17-0.973838010.00-3
October 33896,523,89163,415,31110.29+0.123938010.26+1
October 33937,345,21265,378,17911.23+0.954338011.32+4
October 33978,495,79264,527,61413.17+1.934838012.63+5
October 340111,172,63361,993,78618.02+4.866838017.89+20
December 34033,691,44762,123,0595.94-12.08223805.79-46
December 34076,203,79658,365,92010.63+4.693938010.26+17
December 341112,963,76359,460,00821.80+11.178438022.11+45
December 341511,344,53965,125,99817.42-4.386538017.11-19
July 341712,801,60865,067,89019.67+2.257538019.74+10
July 34219,892,17755,986,58817.67-2.016938018.16-6
July 34256,658,14456,652,30411.75-5.924438011.58-25
November 34266,518,15862,812,40810.38-1.38373809.74-7
November 34303,640,66663,255,7225.76-4.62223805.79-15
November 34344,323,41864,506,8716.70+0.95243806.32+2
January 34366,663,17561,450,68810.84+4.144138010.79+17
April 34375,094,86365,374,4637.79-3.05283807.37-13
May 34387,687,05365,105,02011.81+4.014538011.84+17
October 34399,889,04864,325,66515.37+3.575738015.00+12
October 344310,593,37557,777,83818.33+2.966938018.16+12
October 344424,523,95854,270,75645.19+26.8517238045.26+103
October 344812,458,92460,097,52420.73-24.467938020.79-93
October 345216,010,97465,162,04424.57+3.849338024.47+14
October 34556,667,94864,624,31210.32-14.25373809.74-56
December 34575,654,57161,196,2519.24-1.08353809.21-2
February 34609,648,59764,156,90015.04+5.805738015.00+22
February 34644,667,74862,466,0697.47-7.57283807.37-29
February 346811,949,97766,474,23717.98+10.506738017.63+39
February 34727,400,73763,252,60611.70-6.284438011.58-23
February 34767,207,81260,168,23411.98+0.284538011.84+1
February 34807,222,91256,046,79012.89+0.914738012.37+2
February 34846,758,08957,193,11411.82-1.074438011.58-3
February 34886,898,38855,191,66912.50+0.684538011.84+1
February 34926,677,92455,323,77312.07-0.434538011.84+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Interim National Democratic Congress.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521

BillCreatedVoting startedVoteBill StatusResult
Sexual Morality ActApril 2587April 2587defeated
Title Change BillJanuary 2587January 2587passed
Immigration PolicyJanuary 2587January 2587defeated
Crossdressing BanJanuary 2587January 2587defeated
Anti-Drug PolicyJanuary 2587January 2587defeated
Pledge BillJanuary 2587January 2587defeated
Pro Life MeasureJanuary 2587January 2587defeated
Eminent Domain ReviewJanuary 2587January 2587defeated
Religious Freedom ActJanuary 2587January 2587defeated
Religious Taxation ReformJanuary 2587January 2587defeated
Death Pentalty WithdrawJanuary 2587January 2587defeated
Foreign Moral ReformJanuary 2587January 2587defeated
Government Restriction AmendmentsDecember 2586December 2586defeated
DOK Economic Plan (2587)December 2586December 2586defeated
Party Proposal QuotaDecember 2586December 2586passed
Military Aggression InitiationDecember 2586December 2586defeated
Bill To Change Name of Deltaria Act of 2585December 2585December 2585passed
Ratification of the Global Emancipation TreatyMay 2585May 2585passed
Budget proposal of April 2585April 2585April 2585passed
Budget proposal of January 2585January 2585April 2585defeated

Random fact: The grey space in the east is populated by the forum-based countries, known in-game as the former colonies or the "Third World". These countries are managed by the Third World Coordinator but players can request control of individual countries in the Third World Control Requests thread: http://forum.particracy.net/viewtopic.php?f=11&t=8302

Random quote: "If voting changed anything, they'd abolish it." - Ken Livingstone

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52