Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5500
Next month in: 00:15:03
Server time: 23:44:56, June 16, 2024 CET
Currently online (3): Infinite | j9999 | manutd5859 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


The Teachers’ Guild[?]

This page contains information about the The Teachers’ Guild.

This party is inactive.

Details

User[?]: Red Or Dead

Nation[?]: Ikradonian Union (Ikradon)

Seats[?] in Federale Kamer (Federal Chamber)[?]: 0

Color[?]:

 

Description[?]:

The Teachers' Party works to lift up the educators of this nation and return them to the high regard they once held. We, The Teachers' Party will continue to push for education reform and proper educational proposals.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalisthighperfect
Civil Rightsconvinced permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsextreme internationalistclose to noneperfect
Government Responsibilitiesconvinced big governmenthighperfect
Marketconvinced regulatormoderateperfect
Militaryunknownclose to noneperfect
Moralityconvinced progressivelimitedperfect
Religionmoderate secularclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 483040,92664,822,7590.06+0.0605990.00+0
January 483214,943,36441,117,77336.34+36.2827475036.53+274
September 483312,616,16546,201,22827.31-9.0420575027.33-69
September 483619,419,06848,796,75139.80+12.4929775039.60+92
September 483917,582,44846,384,04437.91-1.8928275037.60-15

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the The Teachers’ Guild.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383

BillCreatedVoting startedVoteBill StatusResult
Ratification of the The Neuhaus PactJanuary 4258November 4258defeated
Ratification of the Mordusian-Hawu Treaty of FriendshipJanuary 4258November 4258defeated
Ratification of the Kazulia-Hawu-Mumenhes Trade AgreementJanuary 4258November 4258defeated
Interim Cabinet to Deal with BombingAugust 4257August 4257passed
ḥꜥȝsu Mnhs Mepr-`3tiry (Constitution of Hawu Mumenhes)November 4256December 4257passed
"Budget proposal" of October 4256October 4256April 4257defeated
Federationists' 4256 Campaign PlatformDecember 4255January 4256defeated
Security Council Support ActMay 4254October 4254passed
Public Domain Privatization Act (PDPA)April 4254October 4254passed
Conservative Party PlatformMay 4253May 4253defeated
Federationist's 4256 Campaign PlatformJune 4252June 4252defeated
OOC: RP IdeasMay 4252January 4261defeated
Conservative Party Platform: Economic Liberalisation IIApril 4252May 4252defeated
Conservative Party Platform: Economic Liberalisation IApril 4252May 4252passed
The Hyperion Way: Military RestructuringDecember 4251December 4251passed
The Hyperion Way: Economic RestructuringNovember 4251July 4252passed
The Hyperion WayOctober 4251August 4260defeated
Cabinet Proposal of October 4251October 4251October 4251passed
Federationist's 4152 Campaign PlatformOctober 4251October 4251passed
Social Liberalization ActJuly 4251October 4251passed

Random fact: Particracy does not allow real-life brand names (eg. Coca Cola, McDonalds, Microsoft). However, in the case of military equipment brand names it is permitted to use simple number-letter combinations (eg. T-90 and F-22) borrowed from real life, and also simple generic names, like those of animals (eg. Leopard and Jaguar).

Random quote: "Whenever a separation is made between liberty and justice, neither, in my opinion, is safe." - Edmund Burke

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51