Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5498
Next month in: 01:45:19
Server time: 06:14:40, June 14, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Falkun Klabb[?]

This page contains information about the Falkun Klabb.

This party is inactive.

Details

User[?]: ReddyCild

Nation[?]: Gran Prinċipat ta’ Kildanja (Cildania)

Seats[?] in Kunsill tad-Deputati (Council of Deputies)[?]: 0

Color[?]:

 

Description[?]:

The Falcon Club is a Cildanian political association composed mainly of members of the Cildanian aristocracy, business elites and "Old Qildar" nationalists. The Club developed from an ancient secret society after dinner debating assocation to a political movement in 5078 taking advantage of longstanding political instability to enter the political scene.

Policies
- Conservatism (official)
- Oligarchy
- Authoritarianism
- Economic liberalism

Leadership
The Club has no formal leadership structures but is believed to operate in the manner of a secret society with hidden leadership structures. The Club endorses its candidates in election with its golden falcon stamp.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightspermissive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsextreme internationalistlimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate laissez-fairehighperfect
Militaryextreme militaristlimitedperfect
Moralitymoderate progressivelimitedperfect
Religionunknownclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 507912,508,23212,508,232100.00+100.00600600100.00+600
June 508111,530,41111,530,411100.00+0.00104104100.00-496
June 508311,897,39511,897,395100.00+0.00104104100.00+0
June 508510,939,88810,939,888100.00+0.00104104100.00+0
June 508712,018,00312,018,003100.00+0.00104104100.00+0
June 508912,175,88412,175,884100.00+0.00104104100.00+0
June 509111,904,07711,904,077100.00+0.00104104100.00+0
June 509311,964,37911,964,379100.00+0.00104104100.00+0
June 509510,976,23110,976,231100.00+0.00104104100.00+0
June 509711,708,11811,708,118100.00+0.00104104100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Falkun Klabb.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448

BillCreatedVoting startedVoteBill StatusResult
Food labellingJanuary 2433January 2433passed
Media ReformOctober 2432October 2432defeated
Safety Regulation StanceOctober 2432October 2432passed
Energy Regulation StanceOctober 2432October 2432passed
Employer Rights StanceOctober 2432October 2432defeated
Minimum Wage StanceOctober 2432October 2432defeated
Discrimination in Hiring StanceOctober 2432October 2432defeated
Curfew StanceOctober 2432October 2432defeated
Charter School StanceOctober 2432October 2432defeated
Pre-school StanceOctober 2432October 2432defeated
Education StanceOctober 2432October 2432passed
Broadcast Pornography StanceOctober 2432October 2432defeated
Space StanceOctober 2432October 2432defeated
National Park StanceOctober 2432October 2432defeated
Recycling StanceOctober 2432October 2432defeated
Farm Subsidies StanceOctober 2432October 2432defeated
Assembly StanceOctober 2432October 2432defeated
Gun OwnershipOctober 2432October 2432passed
Eminent Domain StanceOctober 2432October 2432passed
Housing StanceOctober 2432October 2432defeated

Random fact: Players who consent to a particular role-play by acknowledging it in their own role-play cannot then disown it or withdraw their consent from it. For example, if player A role-plays the assassination of player B's character, and player B then acknowledges the assassination in a news post, but then backtracks and insists the assassination did not happen, then he will be required under the rules to accept the validity of the assassination role-play.

Random quote: "There is only one corner of the universe you can be certain of improving, and that's your own self." - Aldous Huxley

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51