Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:33:03
Server time: 16:26:56, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


The Federal Whig Party[?]

This page contains information about the The Federal Whig Party.

This party is inactive.

Details

User[?]: Vilnius

Nation[?]: Republic of Beluzia (Beluzia)

Seats[?] in Assembly of Deputies[?]: 0

Color[?]:

 

Description[?]:

The Federal Whig Party is a major party that has been heavily involved in Beluzia’s politics, serving as a major force in the nation on and off since 4998. Founded by a group of disaffected Beluzians, the Whigs have typically held a strong and consistent policy record, especially with regards to finance. The Whigs are also known for their fiery, combative nature; they tend to be the most outspoken party on key issues, particularly when it comes to individual liberties, protecting the working class, and upholding financial stability.

Key parts of New Whig Way of thought include a renewed interest in individual liberties, national sovereignty, military strength, fiscal responsibility, Wig Conservatism, and Monarchy. The Whigs passed major federal legislation on multiple occasions, such as the Modern Economic Aid & Development Acts (more commonly called “MEAD Acts”), the Living Inexpensively for Eternity Act (“LIFE”), and the Social Progress Act. These acts raised sufficient revenue to boost economic development, reformed housing construction laws to better oversee growth in urban centers, and increased the autonomy of average citizens from day-to-day life.

The most recent iteration of the party was revived by Edward Thorpe in 5228 (and dissolved by 5279) as a more center-right to conservative party that embraces monarchism rather than a presidency, as well as politicizing various federal positions. Centralization of the government, not devolution, is key to the platform now. Thorpe nominated Lucille Pemberton, a long-time Whig whom had served in Parliament and the Cabinet, as the best choice for Beluzia's first monarch in centuries. Pemberton accepted, though she emphasized that she would merely play a ceremonial role and not an active role in government. Her eldest son, Harold, has agreed to replace her as the next choice, thereby establishing a new line of succession for the throne.

Alistair Durant (5049-5151, age 102) was the longest-serving and most successful Whig President, serving for 15 years from 5096 to 5111. He has been referred to as "the father of the Whig Party," in contrast to the very successful, very famous financier John Amos Mattox III. Mattox (5032-5163) spent a record 51 years as Finance Minister (5056-5107) before serving as Prime Minister at the request of President Durant from 5107 to 5111. Mattox stepped into the role of elder statesman with Durant, and both remained good friends on fine terms. Mattox is called the Father of Beluzian Finance as his economic models were by far the best in Beluzia's history, resulitng in the Ehigs' close connection to the Ministry of Finance.

Whig Presidents:
Cassandra Hepburn-Smith (5013-5020)
Roy Davis (5064-5068)
Alistair Durant I (5096-5111)
Burke Armstrong (5155-5158)
Ronald "Ronnie" Truman (5158-5162)
Helmer Christie (5211-5214, 5221-5228)
Guinevere Hamilton (5228-5237)
Alistair Durant IV (5470-Present)

Parliamentary Leadership Positions:
Eduardo Thorpe (Whig Chair Leader), serving as an MP from Bamburgh
Yvette Mayberry (Whig Whip), serving as an MP from Negunia
Isaiah Johnson-Warner (Whig Floor Leader), serving as an MP from Bamburgh

National Party Leaders:
Alistair Durant IV (national chair)
Ellis Hendershot (vice chair)
Sterling Gray (vice chair)

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristexcellentperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninghighperfect
Government Responsibilitiesconvinced big governmentexcellentperfect
Marketconvinced regulatorhighperfect
Militarypacifist-leaningmoderateperfect
Moralityconservative-leaningexcellentperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 49982,659,88458,332,7464.56+4.56296504.46+29
June 50026,521,54158,669,82111.12+6.567365011.23+44
June 500611,417,12457,496,24219.86+8.7413065020.00+57
September 500910,143,13657,127,25917.76-2.1011665017.85-14
September 501315,564,42351,744,47330.08+12.3219265029.54+76
October 501617,659,48054,897,50532.17+2.0923575031.33+43
October 502013,239,43054,059,39824.49-7.6818375024.40-52
October 502411,720,66754,208,83421.62-2.8716275021.60-21
October 50288,354,26158,934,64914.18-7.4510875014.40-54
January 503011,687,98553,813,72721.72+7.5416575022.00+57
January 50347,535,86756,743,88513.28-8.4410075013.33-65
January 50388,724,52064,678,23313.49+0.2110175013.47+1
September 50388,609,23564,235,48813.40-0.099875013.07-3
September 50426,871,00558,966,65811.65-1.758675011.47-12
November 50427,218,22660,349,36311.96+0.318875011.73+2
December 50448,982,20259,298,15015.15+3.1911275014.93+24
July 50458,901,71154,863,24616.23+1.0812075016.00+8
September 504810,934,54648,385,03222.60+6.3716975022.53+49
September 505215,049,20150,084,60930.05+7.4522675030.13+57
September 505613,949,50049,755,61828.04-2.0120975027.87-17
September 506013,349,25248,941,75127.28-0.7620475027.20-5
September 506425,544,92963,063,53940.51+13.2330575040.67+101
September 506814,995,72853,329,88228.12-12.3921375028.40-92
September 507211,588,15663,592,93418.22-9.9013775018.27-76
September 50766,299,24055,987,88011.25-6.978575011.33-52
September 50775,961,49454,279,82310.98-0.278275010.93-3
September 50815,595,74752,810,67510.60-0.398075010.67-2
September 50856,141,96151,190,64012.00+1.408975011.87+9
December 50888,713,95551,445,01716.94+4.9412275016.27+33
December 50929,232,90052,217,56417.68+0.7413175017.47+9
December 509618,348,68753,348,54234.39+16.7123375031.07+102
September 509917,724,81658,120,36030.50-3.9022575030.00-8
January 510318,846,03658,222,23332.37+1.8723375031.07+8
January 510723,356,34059,646,29739.16+6.7928475037.87+51
January 51117,863,00051,220,44815.35-23.8111575015.33-169
September 51127,966,50556,695,64214.05-1.3010675014.13-9
January 511612,451,22853,149,25223.43+9.3817875023.73+72
January 512017,890,19763,399,34028.22+4.7921275028.27+34
January 512415,687,01165,037,60424.12-4.1018175024.13-31
January 512817,514,83866,854,32626.20+2.0819775026.27+16
July 515523,989,61860,007,84739.98+13.7830075040.00+103
June 515814,457,54260,805,11023.78-16.2018075024.00-120
June 51626,835,25760,741,85111.25-12.526760011.17-113
June 516610,806,41465,047,74016.61+5.3610060016.67+33
May 516810,985,29964,790,96416.95+0.3412775016.93+27
May 517110,764,44264,282,61716.75-0.2112675016.80-1
May 51749,343,34459,889,35115.60-1.1411775015.60-9
May 51776,948,17960,530,33811.48-4.128575011.33-32
May 51803,741,31159,492,9496.29-5.19497506.53-36
May 51834,442,87259,350,7177.49+1.20577507.60+8
November 51844,927,51557,193,1648.62+1.13697509.20+12
November 51876,542,53555,896,83511.70+3.099275012.27+23
November 519012,349,71466,799,42318.49+6.7813975018.53+47
November 519312,258,55557,551,15921.30+2.8116975022.53+30
April 51966,133,85061,429,6849.99-11.327575010.00-94
June 51984,834,19965,806,4637.35-2.64547507.20-21
June 52014,288,26759,330,6477.23-0.12547507.20+0
May 52045,469,39655,229,7989.90+2.68737509.73+19
May 52077,212,02363,301,96911.39+1.498475011.20+11
May 52103,908,70961,598,4706.35-5.05477506.27-37
September 52118,998,32560,084,42314.98+8.6311275014.93+65
September 52147,938,84059,077,25013.44-1.5410075013.33-12
September 52178,518,48165,246,97613.06-0.389875013.07-2
September 52205,391,39164,280,8568.39-4.67627508.27-36
April 522116,139,11159,088,40027.31+18.9320975027.87+147
April 522411,198,06658,874,84819.02-8.2914675019.47-63
October 522622,511,05654,623,29241.21+22.1930375040.40+157
November 522821,900,32553,154,96241.20-0.0130675040.80+3
May 523210,889,05259,088,28418.43-22.7713875018.40-168
November 523513,974,53860,462,77323.11+4.6817175022.80+33
August 523710,830,60563,248,75017.12-5.9912575016.67-46
September 52398,706,19457,142,32615.24-1.8911775015.60-8
November 525917,160,28963,688,52726.94+11.7120275026.93+85
May 526315,565,58754,987,82928.31+1.3621075028.00+8
November 526614,788,12754,781,97526.99-1.3119975026.53-11
May 527012,972,93357,104,62322.72-4.2817275022.93-27
November 52737,905,13464,629,32212.23-10.499075012.00-82
May 52775,947,74864,354,7029.24-2.99687509.07-22
July 546957,582,97057,624,76599.93+90.69500500100.00+432
August 547035,315,43043,268,58981.62-18.3160775080.93+107
August 547211,671,96611,719,05399.60+17.98750750100.00+143
October 547212,168,13612,202,62599.72+0.12750750100.00+0
October 547411,567,06211,567,062100.00+0.28750750100.00+0
January 547512,124,51012,124,510100.00+0.00750750100.00+0
January 547712,476,10112,520,35999.65-0.35750750100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the The Federal Whig Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789

BillCreatedVoting startedVoteBill StatusResult
For Monarchy!February 3694February 3694defeated
Age of adulthoodJanuary 3694January 3694passed
Eminent domain reformJanuary 3694January 3694passed
18th Common Sense BillJanuary 3694January 3694defeated
For Reform IIDecember 3693December 3693defeated
For Reform IDecember 3693December 3693defeated
separation of the executiveDecember 3693December 3693defeated
Budget proposal of October 3693October 3693October 3693passed
st6October 3693October 3693passed
st5February 3693February 3693passed
Income tax proposal of September 3692September 3692September 3692passed
st4September 3692September 3692passed
Budget proposal of September 3692September 3692September 3692passed
Military reform votingJune 3692December 3692passed
Private train companiesMarch 3692March 3692defeated
allow private fishingSeptember 3691February 3692passed
st3September 3691September 3691passed
No duelsMarch 3691March 3691defeated
Allow foreign investmetsJanuary 3691March 3691defeated
Decrease the abnormal luxury tax rate.January 3691March 3691defeated

Random fact: Voters have an extra appreciation for bills that actually get passed, so if you want to maximally take profit from your votes, make sure you compromise with others.

Random quote: "Communism is like prohibition, it's a good idea but it won't work." - Will Rogers

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51