Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5563
Next month in: 03:46:07
Server time: 00:13:52, November 01, 2024 CET
Currently online (4): AR Drax | globerton | Infinite | Luna11 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


The Freedom Party[?]

This page contains information about the The Freedom Party.

This party is inactive.

Details

User[?]: Dr. N.C. Curtis

Nation[?]: Democratic Republic of Talmoria (Talmoria)

Seats[?] in National Assembly[?]: 0

Color[?]:

 

Description[?]:

A government must not interfere with a citizen's personal life more than what common sense provides for.

Current Leadership:
Party Chairman- Jack Pearson
Vice-Chairman- Vice President Bill Goulding

Government Officials:
President: Jesse Wishmaster
Vice-President: Cary Hilton
Assembly Minority Leader: Donald Francis
Assembly Minority WHIP: Jessica Warren

Founded by revolutionaries trying to overthrow the Radical Feminists regime in the early 3300's.

Executive History:

Dr. Nathan Britt (3313-3325, 3337-3339)
VP: Allen Spalding (3313-3317)
VP: Stephen Lowell (3317-3325)
VP: Washington Jeckyll (3337-3339)

Terry McDonnell (3325-3333)
VP: Redd Kennedy (3325-3326)
VP: Romain Davis (3326-3333)

Gen. Perry Sampson (3333-3337)
VP: Harry Wallace (3333-3337)

Dr. Washington Jeckyll (3347-3355)
VP:Bill Goulding (3347-3355)

Jesse Wishmaster (3355-)
VP: Cary Hilton (3355-)

Party Chairmen:
Romain Davis (3313-3326)
Dr. Nathan Britt (3326-3333)
Terry Ashcraft (3333-3340)
Terry McDonnell (3340-3349)
Tommy Bingham (3349-3355)
Jack Pearson (3355-)

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaningmoderateperfect
Militarymoderate militaristlimitedperfect
Moralityconservative-leaningmoderateperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 330347,23054,346,5480.09+0.0901000.00+0
October 330648,20250,285,9820.10+0.0101000.00+0
June 330912,079,67212,118,62999.68+99.58100100100.00+100
June 331111,871,20911,894,91399.80+0.12100100100.00+0
January 331311,658,73911,658,739100.00+0.20100100100.00+0
January 331734,259,90346,894,90173.06-26.9435650071.20+256
January 332132,509,00262,556,65451.97-21.0925950051.80-97
January 332532,020,77849,943,05264.11+12.1531850063.60+59
January 332932,398,21149,223,80665.82+1.7031950063.80+1
January 333329,787,43847,303,32562.97-2.856010060.00-259
January 333738,762,88961,632,97562.89-0.086210062.00+2
June 334335,871,58060,701,46459.10-3.805710057.00-5
June 334735,842,64562,065,44057.75-1.355710057.00+0
June 335127,447,30844,225,62262.06+4.315610056.00-1
June 33557,556,64722,599,51133.44-28.624410044.00-12

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the The Freedom Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261

BillCreatedVoting startedVoteBill StatusResult
Public Transport (Funding) BillMay 4220September 4220passed
Post Office (Private) BillMay 4220September 4220passed
Nuclear Power BillMay 4220September 4220passed
Energy (Liberalisation) BillMay 4220September 4220defeated
Eminent Domain (Legalisation) BillMay 4220September 4220passed
Airport (Liberalisation) BillMay 4220September 4220passed
New Flag BillApril 4220December 4220defeated
Cabinet Proposal of April 4220April 4220May 4220passed
Religion Bill 4220March 4220March 4220defeated
Government Minimizal BillMarch 4220March 4220defeated
People's Freedom BillFebruary 4220February 4220defeated
Intelligence and Counterintelligence BillJuly 4219November 4221passed
Defence Industry BillJuly 4219November 4221passed
Nation Protection BillMay 4219May 4219defeated
Prostitution BillMay 4219May 4219passed
Freedom of Markets BillMarch 4219March 4219defeated
Abolition of Slander Laws BillMarch 4219March 4219defeated
Video Game Regulation BillFebruary 4219May 4220passed
Civil Rights BillFebruary 4219May 4220defeated
Strike (Restriction) BillNovember 4218November 4218defeated

Random fact: Before choosing a nation, you may wish to research it first. For more information on the cultural backgrounds of the nations, please see the Cultural Protocols Index: http://forum.particracy.net/viewtopic.php?f=11&t=6365

Random quote: "There is only one corner of the universe you can be certain of improving, and that's your own self." - Aldous Huxley

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51