Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 02:31:01
Server time: 17:28:58, November 24, 2024 CET
Currently online (1): AR Drax | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Party of Marxist Unification[?]

This page contains information about the Party of Marxist Unification.

This party is inactive.

Details

User[?]: pastradamus

Nation[?]: Yekobura Fēdērēshini (Cobura)

Seats[?] in Chamber of Workers Deputies[?]: 0

Color[?]:

 

Description[?]:

Founded: October 2732 - After the Local CNT union went on strike and decided to go political. Growth of discontent was moving throughout Cobura at the Failing's of the right-wing government and the Newly formed party members occupied factories throughout the country. The workers were executed by government troops and are seen as martyrs by the current party members.This has become know as the Glorious Revolt.

First Election: April 2733
Party Leader: Karl Marx.
Head quaters: Crystal Tokyo City - Dilganato
Union Wing: The CNT

Militant Wing: The Revolutionary Armed Forces of Cobura. (RAFC-PMU)
Status: Formerly involved bombing campagin against landowners in Egato. With 7 members on hungerstrike inside government prisons. Engaged a successful battle against government troops in the southern Domale provience and currently holds 25 troops captive. A ceasefire was agreed and our POW's released.

The RAFC are currently in an active campagin against foreign powers attempting to muster revisionist support in working class areas as well as having successfully destroyed all other revisionist militia's in Cobura and in Crystal Tokyo city the RAFC defeated Government troops after pogroms against the Working class union members occured.

In 2810 the PMU went from a small party to the biggest party in Cobura which achieved a majority in the senate and was the sole ministerial party which also held the presidency.


NO PASARAN ! A LAS BARRICADAS!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistlimitedperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketconvinced regulatorhighperfect
Militaryconvinced militaristlimitedperfect
Moralitymoderate progressivemoderateperfect
Religionconvinced secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 2733146,739230,522,9360.06+0.0605000.00+0
April 273538,330,218235,243,49716.29+16.238050016.00+80
October 273650,582,321222,957,28322.69+6.3910950021.80+29
December 273749,871,097225,440,28522.12-0.5710950021.80+0
December 273947,491,831205,213,81823.14+1.0211250022.40+3
December 274141,549,648204,378,46420.33-2.819950019.80-13
December 274383,250,375201,749,40041.26+20.9320050040.00+101
April 274456,482,457176,680,78531.97-9.3015950031.80-41
April 274660,971,242186,459,39232.70+0.7316350032.60+4
October 274697,963,572245,934,70539.83+7.1320150040.20+38
October 274859,660,242239,773,51824.88-14.9512550025.00-76
October 275055,023,751249,431,16922.06-2.8211250022.40-13
October 275239,655,204238,602,86516.62-5.448450016.80-28
October 275432,257,859244,962,77713.17-3.456650013.20-18
October 275632,654,356245,004,39313.33+0.166750013.40+1
October 275822,427,638251,509,2898.92-4.41445008.80-23
October 276017,067,398232,112,7517.35-1.56355007.00-9
October 276241,573,743229,439,76418.12+10.779050018.00+55
December 276337,863,989253,726,04314.92-3.207550015.00-15
December 276542,953,085261,732,23116.41+1.499860116.31+23
December 276734,387,177246,336,65713.96-2.458360113.81-15
April 276930,720,857251,625,19112.21-1.757260111.98-11
December 277048,953,935263,707,85918.56+6.3511360118.80+41
December 277338,110,672262,606,95114.51-4.058660114.31-27
December 277629,622,134237,212,96312.49-2.027360112.15-13
December 277925,374,042267,460,3959.49-3.00566019.32-17
December 278320,107,192236,270,2628.51-0.98496018.15-7
December 278737,430,228236,921,75015.80+7.299560115.81+46
December 279144,710,818164,680,07927.15+11.3516460127.29+69
October 279330,721,435183,919,34016.70-10.458450116.77-80
April 279637,921,597178,137,47521.29+4.5810650121.16+22
October 279839,420,280184,321,92821.39+0.1010650121.16+0
April 280137,676,989183,267,67820.56-0.8310250120.36-4
October 280381,702,387273,509,45929.87+9.3115150130.14+49
April 280666,935,839216,868,58530.86+0.9915350130.54+2
October 2808131,043,950252,963,57351.80+20.9425850151.50+105
April 2811136,024,609234,840,92357.92+6.1228450156.69+26
October 2813125,381,803234,075,46053.56-4.3626850153.49-16
April 2816106,993,298267,851,79739.94-13.6219950139.72-69
October 281880,356,908267,959,44829.99-9.967725330.43-122
April 282177,423,528267,539,44128.94-1.057425329.25-3
October 282368,232,647233,255,48029.25+0.317425329.25+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Party of Marxist Unification.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604

BillCreatedVoting startedVoteBill StatusResult
Executive and Legislative Seperation ActJanuary 2147January 2147defeated
Abortion Realism ActJanuary 2147January 2147defeated
Ratification of the Declaration on the Use of Scientific and Technological Progress in the Interests of Peace and for the Benefit of MankindDecember 2146December 2146defeated
Remuneration of ministers of religionDecember 2146December 2146passed
Ratification of the International Health, Safety, and Welfare TreatyDecember 2146December 2146defeated
Ratification of the United CountriesDecember 2146December 2146defeated
Gwen For Capital CityNovember 2146November 2146defeated
WMD For CoburaNovember 2146November 2146defeated
Small Corporation TaxOctober 2146October 2146passed
Appointment of Religous MinistersApril 2146April 2146passed
Cabinet Proposal ChangeMarch 2146March 2146defeated
Immigration ReformMarch 2146March 2146defeated
A National MediaMarch 2146March 2146defeated
Budget proposal of March 2146March 2146March 2146defeated
Liberal Education ProposalMarch 2146March 2146defeated
Animal Testing for Cosmetic ProductsMarch 2146March 2146passed
Old Times BillFebruary 2146February 2146defeated
Eminent Domain CompensationFebruary 2146February 2146defeated
State Atheism ActFebruary 2146February 2146defeated
PTU, "Liberalisation of finance", taxation and ordinary billsFebruary 2146February 2146defeated

Random fact: Whilst the use of non-English languages can be appropriate for nation names, party names, constitutional titles and other variables, English is the official language of communication in the game. All descriptive texts and public communications should be in English or at least appear alongside a full English translation.

Random quote: "It only takes 20 years for a liberal to become a conservative without changing a single idea." - Robert Anton Wilson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51