Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5500
Next month in: 01:42:56
Server time: 06:17:03, June 18, 2024 CET
Currently online (2): ADM Drax | PiratDun | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Social Liberal Party[?]

This page contains information about the Social Liberal Party.

This party is inactive.

Details

User[?]: SpaghettiMonster89

Nation[?]: Rzeczpospolita Walruzyjska (Valruzian Republic)

Seats[?] in Izba Poselska(Chamber of Deputies)[?]: 0

Color[?]:

 

Description[?]:

The Social Liberal Party are opposed to any sort of restriction on individual behaviours.

The Social Liberal Party support a mixed economy with largely free private industry, but support government regulation on capitalism and a 'safety net' for the poor.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketregulator-leaninghighperfect
Militaryconvinced pacifisthighperfect
Moralityconvinced progressivemoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 2915237,179308,730,0210.08+0.0803750.00+0
July 291745,911,428308,297,71014.89+14.825537514.67+55
October 291932,641,083310,445,60610.51-4.383937510.40-16
January 292240,913,086307,918,70013.29+2.774937513.07+10
April 292440,230,633306,168,55813.14-0.154937513.07+0
July 292676,850,735304,171,71625.27+12.139437525.07+45
October 292876,137,104302,472,35525.17-0.099437525.07+0
January 293172,011,406302,672,05823.79-1.389037524.00-4
April 293377,608,477304,389,05325.50+1.709637525.60+6
July 293575,374,404305,493,40024.67-0.829337524.80-3
October 293769,474,035288,352,62124.09-0.589137524.27-2
January 294070,833,868296,985,75523.85-0.248937523.73-2
April 294272,656,483326,873,83222.23-1.628437522.40-5
July 294479,654,331344,385,52123.13+0.908737523.20+3
October 294677,022,000331,135,36523.26+0.138737523.20+0
January 294965,578,618345,171,70519.00-4.267137518.93-16
April 295193,360,389335,807,75927.80+8.8010637528.27+35
July 295393,592,121343,941,50027.21-0.5910437527.73-2
October 295595,480,278338,030,39328.25+1.0310837528.80+4

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Social Liberal Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400

BillCreatedVoting startedVoteBill StatusResult
Basic Welfare for Adults ActNovember 4302November 4302passed
RP: Governmental Project "Clean Energy for Valruzia 4320" of September 4302September 4302December 4302passed
RP: Reinstallment of "Taxation Bill on the Value-added Tax - Ustawa Podatkowa o Podatku Od Towarów i Usług" Bill, September 4302September 4302December 4302passed
Worker's ActApril 4302November 4302defeated
People's Tax ActFebruary 4302February 4302defeated
Retirement Age Reform of October 4300October 4300October 4300passed
Bill on the Protection of the Republic of Valruzia from External Threats Emerged as the Result of Instabilities on the Continent of Dovani, May 4300May 4300May 4300passed
Nationwide Decree of the President of the Republic of Valruzia - Protecting the Republic from the Threats of Religious CultsOctober 4298October 4298passed
Robert Tomczyk Cabinet Proposal of October 4298October 4298October 4298passed
Ratification of the International Film Societies Organisation (IFSO)October 4297December 4297passed
Ratification of the The Law of the SeaOctober 4297October 4297passed
Ratification of the Istalian Embassy Diplomatic Relations TreatyMay 4297May 4297passed
Budget proposal of March 4297March 4297March 4297passed
Ratification of the Selucian Official Diplomatic TreatyNovember 4296May 4297passed
Ratification of the Official Diplomatic Treaty of the Republic of ValruziaNovember 4296November 4296passed
Ratification of the Official Diplomatic Treaty of the Republic of ValruziaJune 4295June 4295defeated
Ratification of the Anti Slavery TreatyDecember 4294December 4294passed
Homeless Shelter Act of February 4296 - Ustawa o Schroniskach dla Bezdomnych, Luty 4296November 4294February 4296passed
Eminent Domain Act of October 4295 - Ustawa o Wywłaszczeniu, Październik 4295November 4294October 4295passed
Anti-Slavery Embargoes Act of June 4295 - Ustawa o Embargach Anty-Niewolniczych, Czerwiec 4295November 4294June 4295passed

Random fact: In cases where players have failed to clearly and accurately reference their nation's RP laws in the "Bills under debate" section, Moderation will rule them invalid if a challenge is made to their validity.

Random quote: "War crimes is such a lilliputian term for the atrocities committed by the Yeudish state." - Katrine Lorenzen, former Kazulian diplomat

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51