Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5494
Next month in: 00:33:35
Server time: 15:26:24, June 05, 2024 CET
Currently online (5): AethanKal | ImperialLodamun | Irishpoliticianliam | LC73DunMHP | SE33 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Pontesian Progressive Party[?]

This page contains information about the Pontesian Progressive Party.

This party is inactive.

Details

User[?]: eugene1987

Nation[?]: Pontesi Hanrapetut’yun (Pontesi)

Seats[?] in Պոնտեսիայի Ազգային ժողով (National Assembly of Pontesi)[?]: 0

Color[?]:

 

Description[?]:

Founded: April 4246 (by: Alinar Balkian)

Founded on the principle of Civil Freedom, National Security, and State rights the SPP seeks to create a strong Central Government dedicated to the protection of the civilian population, removing Government from the day to day lives of the people by establishing Civil Codes that protect Citizens from overreaching by the Government, and to establish powers of local governments.

=============================================

April 4249: Won majority of seats in Government. Began sweeping changes to create the Republic of Seluciana.

May 4250: Won emergency elections to gain complete control of the Government. Began its work to form a Republic.

November 4251: Party name changed after growing grassroots movement took hold in the nation and a formal request was made to return to the nations former name of Pontesi added to the official title of the "Sovereign Republic of Pontesia"

May 4254: Alinar Balkin is elected as 1st President of the Sovereign Republic of Pontesia bringing back the Republic back to Pontesia.

April 4258: Alinar Balkian is elected as President for his second term for the Sovereign Republic of Pontesia.

=============================================

PPP Presidents of the SRP:
4254 - 4258: Alinar Balkian
4258 - 4262: Alinar Balkian
4262 - 4266:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketmoderate regulatorexcellentperfect
Militarymoderate militaristmoderateperfect
Moralitymoderate progressivehighperfect
Religionsecular-leaninghighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 424925,001,23747,902,81152.19+52.195510055.00+55
April 425011,964,38011,964,380100.00+47.81100100100.00+45
April 425411,442,80111,442,801100.00+0.00100100100.00+0
April 425811,989,90511,989,905100.00+0.00100100100.00+0
April 426236,998,55545,352,22781.58-18.427910079.00-21

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Pontesian Progressive Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330

BillCreatedVoting startedVoteBill StatusResult
Foreign Investment Liberalisation ActAugust 4175August 4175defeated
Social Conservatism For Pontesi!August 4175August 4175defeated
Cabinet Proposal of May 4175May 4175May 4175defeated
Equal RepresentationMay 4175May 4175defeated
Bill to Facilitate the Respective Positions of the Partium Nos and Pontesi Peoples PartyMay 4175May 4175defeated
Pontesi Peoples Party OmnibusMay 4175May 4175defeated
aJanuary 4175January 4175defeated
Call for early elections, January 4175January 4175January 4175defeated
abortionDecember 4174December 4174passed
Change in the title of the houseNovember 4174February 4175defeated
New FlagNovember 4174November 4174defeated
Forestry and Industries ActNovember 4174November 4174defeated
.November 4174November 4174defeated
Change in Title Of the Head of GovernmentNovember 4174November 4174defeated
ChangesOctober 4174October 4174defeated
Nuclear Energy ActAugust 4174August 4174passed
Eminent Domain ActAugust 4174August 4174passed
Space Exploration Regulation ActAugust 4174August 4174passed
Religion ActAugust 4174August 4174passed
Budget proposal of July 4174July 4174July 4174defeated

Random fact: Check out the forum regularly for game news. http://forum.particracy.net/

Random quote: "The only place where democracy comes before work is in the dictionary." - Ralph Nader

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51