Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:19:57
Server time: 16:40:02, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Partidul Aristocraţie[?]

This page contains information about the Partidul Aristocraţie.

This party is inactive.

Details

User[?]: dst33ne

Nation[?]: Republica Chizână (New Endralon and Kizenia)

Seats[?] in Parlamentul Republicii (Republic's Parliament)[?]: 0

Color[?]:

 

Description[?]:

Until being deposed by anarchists in early 3021, the Partidul Aristocraţie ruled Kizenia for nearly two and a half centuries. Now the party is a historical relic, although it may someday arise from the flames like a phoenix to restore sensible government to the Kizenian peoples.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninghighperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketregulator-leaningexcellentperfect
Militarymoderate militaristmoderateperfect
Moralityconservative-leaningmoderateperfect
Religionmoderate secularexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 275687,401,574156,003,50156.03+56.0316730055.67+167
March 276084,653,768188,725,61844.86-11.1713830046.00-29
March 2766103,284,052223,007,87346.31+1.4614030046.67+2
March 277276,236,078219,044,22734.80-11.5110430034.67-36
March 277845,578,906193,104,07823.60-11.207130023.67-33
March 278457,311,020187,491,63530.57+6.969330031.00+22
January 278845,568,63245,568,632100.00+69.43300300100.00+207
May 279245,071,05945,236,86499.63-0.37299299100.00-1
May 279848,219,90248,219,902100.00+0.37299299100.00+0
February 279948,210,09148,210,091100.00+0.007575100.00-224
February 280547,690,78947,690,789100.00+0.007575100.00+0
February 281149,072,62249,072,622100.00+0.007575100.00+0
October 281248,601,13848,805,43099.58-0.427575100.00+0
October 281850,368,79450,368,794100.00+0.427575100.00+0
October 282449,330,43749,330,437100.00+0.007575100.00+0
April 2826242,616,802242,747,25399.95-0.057575100.00+0
January 282998,585,963170,381,18857.86-42.08457560.00-30
January 283591,794,886238,155,36738.54-19.32307540.00-15
June 283794,928,467235,517,41140.31+1.76307540.00+0
June 284096,356,395225,046,45842.82+2.51327542.67+2
June 284698,656,372215,356,36545.81+2.99337544.00+1
June 2852112,645,197207,393,14154.31+8.50397552.00+6
June 2858179,144,053239,243,87174.88+20.56547572.00+15
June 2864304,683,022305,367,43199.78+24.907575100.00+21
June 287057,269,68557,269,685100.00+0.227575100.00+0
June 287656,255,04456,255,044100.00+0.007575100.00+0
June 288261,070,78961,070,789100.00+0.007575100.00+0
June 2888275,195,953275,358,86499.94-0.067575100.00+0
June 2890272,390,408272,667,92099.90-0.047575100.00+0
June 289661,836,75861,836,758100.00+0.107575100.00+0
June 2902307,729,484308,031,84499.90-0.10750750100.00+675
December 2905113,904,094173,765,10665.55-34.3552175069.47-229
December 2911127,556,763221,264,26557.65-7.9042975057.20-92
December 2917218,230,609267,288,39781.65+24.0059675079.47+167
January 292169,534,73569,534,735100.00+18.35750750100.00+154
December 2924333,943,149334,145,71799.94-0.06750750100.00+0
December 2930309,166,904309,370,67099.93-0.01750750100.00+0
September 293570,199,24970,199,249100.00+0.07750750100.00+0
September 294168,050,78868,050,788100.00+0.00750750100.00+0
September 294770,932,33870,932,338100.00+0.00750750100.00+0
September 2953295,403,846296,090,39399.77-0.2374975099.87-1
March 2955274,709,979291,152,40894.35-5.4270175093.47-48
March 2961351,304,664352,593,82399.63+5.2874875099.73+47
March 296780,801,22480,801,224100.00+0.37750750100.00+2
March 297376,697,01676,697,016100.00+0.00750750100.00+0
March 297978,215,24878,215,248100.00+0.00750750100.00+0
March 298580,566,00680,566,006100.00+0.00750750100.00+0
March 299183,144,62783,144,627100.00+0.00750750100.00+0
March 299786,967,68886,967,688100.00+0.00750750100.00+0
January 300090,437,33490,700,54099.71-0.29750750100.00+0
July 300284,130,68785,318,09198.61-1.1074975099.87-1
July 300888,146,40288,644,05699.44+0.8374975099.87+0
June 300981,915,45582,744,20699.00-0.4474975099.87+0
July 300988,941,47589,592,37599.27+0.28750750100.00+1
July 301578,297,882354,783,38122.07-77.2017375023.07-577
July 302088,089,846422,569,31720.85-1.2216575022.00-8

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Partidul Aristocraţie.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387

BillCreatedVoting startedVoteBill StatusResult
Intoxicating Liquor Act 4213June 4212June 4212passed
Defence Forces Act 4213June 4212June 4212passed
Postal Services (Privatization) ActJune 4212June 4212passed
Public Health Act 4212October 4211October 4211passed
Withdrawal from the Koeistad PactMay 4211May 4211passed
Ratification of the International Civil Aviation Organization (ICAO)May 4211May 4211passed
Budget proposal of November 4210November 4210November 4210passed
Income tax proposal of November 4210November 4210November 4210passed
Cabinet Proposal of October 4210 - Károlyi IIOctober 4210October 4210passed
Call for early elections, September 4210September 4210September 4210passed
Eminent Domain Act 4211May 4210October 4210passed
Industrial Relations Act 4210May 4210October 4210passed
Adoption Act 4211May 4210October 4210passed
Ratification of the Trade Agreement between Cele Trei-limbi Uniunea Federală and Federal Republic of EndralonApril 4210October 4210passed
Cabinet Proposal of June 4209 - Károlyi IJune 4209June 4209passed
Ratification of the Trade Agreement between Cele Trei-limbi Uniunea Federală and Federal Republic of EndralonJune 4209June 4209defeated
Aviation Act 4210May 4209May 4209passed
Advertising Act 4210May 4209May 4209passed
Social Welfare Act 4210May 4209May 4209passed
Waste Management Act 4209May 4209May 4209passed

Random fact: Moderation will not implement nation renaming requests where the proposed name does not comply with the requirements set out in the Nation Renaming Guide: http://forum.particracy.net/viewtopic.php?f=11&t=6364

Random quote: "A good politician is quite as unthinkable as an honest burglar." H. L. Mencken

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51