Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5486
Next month in: 01:05:36
Server time: 18:54:23, May 19, 2024 CET
Currently online (1): Mbites2 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Christian National Awakening Council[?]

This page contains information about the Christian National Awakening Council.

This party is inactive.

Details

User[?]: Hockey

Nation[?]: WrnukaƩk Konzknstat (Vanuku)

Seats[?] in Jez Bltmojad (Grand Council)[?]: 0

Color[?]:

 

Description[?]:

For too long have people been spared the right to practice their own religion, sexuality and tradition in peace. The Christian National Awakening Council (CNAC) was founded in December 2707 to loosen the grip of the homosexual elite on the people of Antinopolis. While we advocate drastic and significant change to the laws and culture of Antinopolis, we maintain that we are dedicated to the political process and seek to achieve our aims through the functions of our democracy.

Leader: John Miller (December 2707 - )
Deputy Leader: Tim Roth (December 2707)

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsunknownclose to noneperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaninglimitedperfect
Militaryextreme militaristclose to noneperfect
Moralityconservative-leaninglimitedperfect
Religionconvinced religiousmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 271012,252,368151,536,1908.09+8.0981206.67+8
August 271338,573,156197,275,79319.55+11.475830019.33+50

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Christian National Awakening Council.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291

BillCreatedVoting startedVoteBill StatusResult
Local Executive ActSeptember 2146September 2146passed
Introduction And Establishment Of Trade SchoolsJune 2146June 2146passed
Minimum Age To Hold A Gun LicenceJune 2146June 2146defeated
Gun RegulationMay 2146May 2146passed
Call for early elections, November 2145November 2145November 2145defeated
Cabinet ActOctober 2145October 2145passed
Forign Aid ActOctober 2145October 2145passed
Prime Minister Act - with proposal (oops on my part)September 2145September 2145defeated
30 Month Term ActSeptember 2145September 2145defeated
Prime Minister ActSeptember 2145September 2145passed
Domain Compansation ActSeptember 2145September 2145passed
Foreign Affairs Act 2144November 2144November 2144defeated
Vanuku BillApril 2144April 2144passed
Call for early elections, October 2143October 2143October 2143defeated
Contraception ActOctober 2143October 2143passed
Federal Democratic Republic of Vanuku Specific Act 2142August 2143August 2143defeated
Election Periods ActMay 2143May 2143defeated
Alt. Fireworks ActDecember 2142December 2142defeated
Alt. Smoking ActDecember 2142December 2142defeated
Defence Admendment Act 2142December 2142December 2142defeated

Random fact: Jelbic = "Group of cultures with an overall Central Asian/Eurasian steppe theme, using a fictional language developed specifically for Particracy".

Random quote: "In an underdeveloped country, don't drink the water; in a developed country, don't breathe the air." - Changing Times magazine

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51