Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5480
Next month in: 01:10:24
Server time: 06:49:35, May 08, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Kommunisticheskaya Partiya Trigunii[?]

This page contains information about the Kommunisticheskaya Partiya Trigunii.

This party is inactive.

Details

User[?]: unReddy

Nation[?]: Trigunskaya Imperiya (Trigunia)

Seats[?] in Императорская Дума; tr. Imperatorskaya Duma (Imperial Duma)[?]: 0

Color[?]:

 

Description[?]:

COMMUNIST PARTY OF TRIGUNIA

Founded: September 4059


The KPT is a Metzist-Leonidist political party active in the Trigunian Federation. It was founded in 4059 following a period of some uncertainty after the fall of the One Trigunia regime.

Leadership

General Secretary: Nikolai Zhukov


Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristexcellentperfect
Civil Rightsmoderate restrictiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistexcellentperfect
Government Responsibilitiesconvinced big governmentexcellentperfect
Marketmoderate regulatorexcellentperfect
Militarymoderate militaristlimitedperfect
Moralityconservative-leaningexcellentperfect
Religionsecular-leaningexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 35928,790,99246,661,74818.84+18.84137517.33+13
December 405912,176,56912,176,569100.00+81.16500500100.00+487

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Kommunisticheskaya Partiya Trigunii.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of December 2419December 2419December 2419defeated
Ratification of the Keymon Neutrality AgreementNovember 2419June 2421defeated
Ratification of the InterpolNovember 2419June 2421defeated
Final renaming of legislatureJanuary 2419January 2419passed
Right to Assembly ActSeptember 2418September 2418passed
Education BillSeptember 2418September 2418passed
Hybrid Government BillMarch 2418March 2418passed
National Forest Protection ActFebruary 2418September 2418defeated
Captial Establishment ActFebruary 2418April 2418passed
Alternative Eminant DomainAugust 2417August 2417defeated
Cabinet Proposal of August 2417August 2417August 2417passed
Chemicals Testing ActJuly 2417July 2417defeated
Fishing Rights ActJuly 2417July 2417defeated
Individual Privacy ActJuly 2417July 2417passed
Foreign Visitors ActJuly 2417July 2417passed
Transport Funding ActJuly 2417July 2417defeated
Gated Communities BanJune 2417September 2417defeated
Rights Of The Accused ActJune 2417September 2417passed
Eminent Domain Treatment ActJune 2417September 2417passed
Eminent Domain ActJune 2417September 2417defeated

Random fact: You can view who's online (i.e. been active the last 10 minutes) at the bottom of the menu (either at the top or the side).

Random quote: "The only place where democracy comes before work is in the dictionary." - Ralph Nader

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51