Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5479
Next month in: 00:00:59
Server time: 23:59:00, May 06, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


SEE Party[?]

This page contains information about the SEE Party.

This party is inactive.

Details

User[?]: fastbow

Nation[?]: Empire of Ananto and Kalistan (Kalistan)

Seats[?] in National Assembly of Deputies[?]: 0

Color[?]:

 

Description[?]:

In recognition of the will of the people of Kalistan, and in recognition of the cooperative attitudes of the mainstream Kalistani party, The Party of the Opposition hereby publishes this attestation of official party positions and attitudes.

Due to our newfound place in the mainstream of Kalistani politics, the Party of the Opposition hereby recognizes that blind opposition and open hostility are no longer productive. The people of Kalistan desire for our party to take a leadership role in this nation, and we need to recognize this. To this end,w e renounce hostile rhetoric in the production and debate of legislation.

To this end of taking our rightful place in Kalistani government, we hereby publish this list of official party stances, recognizing that blind opposition does not make for a productive political platform.

Administration: The party has no desire to change traditional Kalistani culture.
Military: The party desires a strong national defense, with no potential advantage left unexploited. However, this strong military presence must be balanced against the individual rights of the person.
Health: The party recognizes the need for certain basic public health institutes and that the government has a duty to protect its citizens. However, the party holds that the government should not be financially responsible for the discretionary medical expenses of its citizens.
Economics: The party is decidedly free-market, seeking to reinforce the rights of the individual in the market against the tyranny of the collective. The party also believes that the market should not be manipulated to punish the achievement of the individual.
Justice: The party believes in a firm but just system, with a high emphasis on the preservation of the rights of the individual.
Education: The party believes in a strong educational system, with national content standards to secure basic competency. However, these standards should be skills-focused, not content-focused, to allow for local discretion in the system.
Media: The party believes in a free and accessible media with minimal state interference. Nothing should exist to prevent people from profiting from privately held media entities.
Culture: The party believes that the state should support the state's culture, and the creators of said culture. Simultaneously, the state should not be the only source of support for cultural movers.
Science: The party believes in tempering science with an eye towards the public welfare.
Technology: The party believes technology is the future of Kalistan, but this motive must be balanced by the recognition that economic achievement is a motivator for technological achievement.
Ecology: The party believes in reasonable, responsible use and maintenance of the environment.
Agriculture: The party believes that agriculture is an important sector for personal economic achievement, but this achievement must be tempered with an eye towards the future.
Civil Liberties: The party is against restrictions of civil liberties, except as they infringe on the rights of fellow men.
Foreign Policy: The party believes Kalistan is Kalistan's first responsibility. While all people are welcome in Kalistan, Kalistan's own attentions should turn inward. Additionally, the party is against any external attempts to dictate law to Kalistan. Kalistan should be governed by Kalistanis alone.
Infrastructure: The party believes in government construction and maintenance for the good of the country, but also in allowing private companies to invest in infrastructure as well.
Welfare: The party is not opposed to welfare, but believes it should be limited in scope, and if possible, in cost.
Religion: The party believes in the free and unlimited exercise of all religions.

In recognition of this change, the Party of the Opposition will change its name to The Party of Sovereignty, Economy, and Egality.

The SEE Party was founded in 3730 by a coalition of disgruntled students and entrepreneurs. Tired of the socialist policies of traditional Kalistani parties, these groups formed a political party of radicals with little guidance. This original group was quickly subsumed by a group of power-hungry government attorneys, who saw the untrained, unrefined energy of this mob as a vehicle to power they couldn't otherwise obtain. This organization was the Party of the Law. This phase of the organization saw little traction, with no legislative victories or even seats gained.

In the early 3740s, the radical element forming the party's power base rebelled against the hijackers, regaining control of the party, and rebranding itself the Party of the Opposition. Through rhetoric of anger, protests, and militia demonstrations, they successfully got their message out, placing their leader, John G. Roberts, into the presidency in 3744. This rhetoric, although effective at getting the message out, was ineffective at creating change, resulting in slow growth and an inability to retain gains made.

After a failed presidential run in 3753 which was marred by several violent demonstrations, including one particularly distasteful incident in the Chamber of Deputies, John G. Roberts implored the party to change, lest they lose what little they had gained. The party responded, rejecting violence as a political tool and rebranding itself as the SEE Party.

After the gains in the election of 3759, the SEE Party found itself in the majority for the first time ever. Unfortunately, the celebration was short-lived as former President John G. Roberts would perish not long after the elections.

Today, the SEE Party retains its militia, as a gesture to its roots and its contribution to Kalistan's defense. But the militia wing is separate from the political wing. The SEE Party now seeks productive change through dialogue, not damage.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiesmoderate small governmentmoderateperfect
Marketregulator-leaningmoderateperfect
Militarymoderate militaristmoderateperfect
Moralityconservative-leaninghighperfect
Religionreligious-leaninghighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 373530,29865,574,3310.05+0.0507500.00+0
February 373843,11566,149,5730.07+0.0207500.00+0
February 37417,504,49464,348,04211.66+11.608775011.60+87
February 374410,901,70164,438,37616.92+5.2613075017.33+43
February 374710,852,16165,652,26316.53-0.3912875017.07-2
February 375021,347,77260,622,84635.21+18.6827175036.13+143
February 375323,136,78362,901,86936.78+1.5728275037.60+11
February 375624,262,93462,629,91738.74+1.9630075040.00+18
February 375922,017,23553,458,35141.19+2.4531275041.60+12
February 376225,824,49062,652,68141.22+0.0331075041.33-2
February 376521,551,60462,696,39934.37-6.8425675034.13-54

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the SEE Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of October 2947October 2947October 2947defeated
City RenamingJuly 2947August 2948defeated
Grand Cabinet Proposal, Version 2.0July 2947July 2947defeated
Civil Rights MovementJuly 2947July 2947defeated
Demilitarization BillJune 2947June 2947defeated
Kalistan's NewspaperJanuary 2947August 2948passed
Government Reduction BillJanuary 2947January 2947defeated
New Year's ResolutionsJanuary 2947January 2947defeated
Grand Cabinet Proposal of November 2946November 2946November 2946defeated
Sales tax on luxury goodsOctober 2946November 2946passed
Cabinet Proposal of September 2946September 2946September 2946defeated
Cabinet Proposal of September 2946September 2946September 2946defeated
Secularization BillJuly 2946September 2946defeated
Modernization of the Kalistani FlagFebruary 2946December 2947passed
KZD OmnibusDecember 2945September 2946defeated
Eminent Domain ActDecember 2945December 2945defeated
Tariff ActDecember 2945December 2945defeated
Freedom of Affection ActDecember 2945December 2945passed
Libel & Slander ActDecember 2945December 2945passed
Bestiality ActDecember 2945December 2945defeated

Random fact: If you want to leave Particracy, please inactivate yourself on your user page to save the moderation team some time.

Random quote: "The greatest lesson in life is to know that even fools are right sometimes." - Winston Churchill

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51