Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5479
Next month in: 03:20:06
Server time: 08:39:53, May 07, 2024 CET
Currently online (1): Caoimhean | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Free Conservative Party[?]

This page contains information about the Free Conservative Party.

This party is inactive.

Details

User[?]: C_Braun

Nation[?]: Jelbék H'ánknstat (Jelbe)

Seats[?] in Bltmojad Knzsrlji Vezr (Council of Royal Advisors)[?]: 0

Color[?]:

 

Description[?]:

To the People,

The world is about money. People, not a overlarge government should decide what to do with it. After all, this is as close to a true democracy as is feasibly possible. People should decide wether to help the poor, to give education grants or loans, help the elderly with perscription drugs. However, there are key things that a government needs to coordinate, like fire stations, police, military, public primary education, etc. This means lower taxes, greater choice to do what people believe in. If people do not agree with a program, they do not have to fund it. This policy does not free the people from the moral obligation to give to charity, but gives them the choice in case they are not in a financial position to, or will not for any other reason. It is up to the people. It is also the people's job to be informed as to what is happening in the world.

Also, the Conservative Party stands for morals. With the exception of rape, the Party takes a pro-life stance against abortion. In answer to the "pro-choice" groups: the woman already made a choice. She should not have the ability to kill an inocent child because of a mistake she made. Standards of marriage should also be set to preserve that which is meant to be a "holy matrimony." Homosexuals are free do do as they wish, but not to break moral boundaries of marriage. We sepparate church and state, much of the moral issues we stand for come from Christianity.

C_Braun

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationfederalist-leaningmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiesconvinced small governmentlimitedperfect
Marketregulator-leaningmoderateperfect
Militaryconvinced militaristclose to noneperfect
Moralityconservative-leaningmoderateperfect
Religionmoderate religiousmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 219831,46545,057,9370.07+0.0705010.00+0
December 220219,02442,957,3350.04-0.0305010.00+0
December 2206708,50943,026,7791.65+1.6075011.40+7
December 221019,883,97345,707,45443.50+41.8621850143.51+211
December 221419,276,09044,950,46242.88-0.6221650143.11-2
December 221715,413,86437,935,23640.63-2.2525362540.48+37
December 222018,327,96742,452,09843.17+2.5426862542.88+15
December 222321,917,59850,109,16143.74+0.5727162543.36+3
June 222812,459,58845,484,20327.39-16.3517062527.20-101
December 22328,037,46946,351,47817.34-10.0510562516.80-65

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Free Conservative Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338

BillCreatedVoting startedVoteBill StatusResult
The Post Office Act of 2484February 2484February 2484passed
The Eminent Domain Act of 2484February 2484February 2484defeated
The Regional Power Grid Act of 2484February 2484February 2484passed
The Fishing Quotas Act of 2484February 2484February 2484passed
The Local Agircultural Policy Act of 2484February 2484February 2484passed
The Pollution Act of 2484February 2484February 2484passed
The Exotic Animals Act of 2484February 2484February 2484passed
The Endangered Animals Act of 2484February 2484February 2484passed
The Pharmecutical Research Act of 2484February 2484February 2484passed
The False Information Act of 2484February 2484February 2484passed
The Teacher Discipline Act of 2484February 2484February 2484defeated
The Children's Freedom Act of 2484February 2484February 2484passed
Democracy on workplace actJanuary 2484May 2484defeated
renewable souces actJanuary 2484May 2484passed
The Pre-School Act of 2484January 2484February 2484passed
The Fair Shot Act of 2484January 2484February 2484passed
The Education Creation Act of 2484January 2484February 2484passed
The National Police Creation Act of 2484January 2484February 2484passed
The Illegal Immigrant Reform Act of 2484January 2484February 2484passed
The Secondary Strike Act of 2484January 2484February 2484passed

Random fact: Your user name is not your party name. Choose a concise and easy to remember user name. You can change your party name at any point in time later in the game.

Random quote: "Our enemies are innovative and resourceful and so are we. They never stop thinking about new ways to harm our country and our people and neither do we." - George W. Bush

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51