Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5483
Next month in: 02:46:29
Server time: 09:13:30, May 15, 2024 CET
Currently online (2): Holy Efelant | Tayes_Gad | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Freedom Party[?]

This page contains information about the Freedom Party.

This party is inactive.

Details

User[?]: derrick0042

Nation[?]: Workers' and Peasants' Ahmadi Emirate of Talmoria (Talmoria)

Seats[?] in Protectorate Assembly[?]: 0

Color[?]:

 

Description[?]:

The Freedom Party aims to provide liberties for all citizens while building national pride and values.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsconvinced permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsextreme internationalistclose to noneperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketmoderate regulatormoderateperfect
Militaryunknownclose to noneperfect
Moralityconservative-leaninglimitedperfect
Religionsecular-leaningclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 41572,226,15463,046,6903.53+3.53185003.60+18
June 41572,476,39661,462,3254.03+0.50215004.20+3
June 41585,055,98060,041,6638.42+4.39425008.40+21
January 41604,805,65057,196,6738.40-0.02415008.20-1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Freedom Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261

BillCreatedVoting startedVoteBill StatusResult
Peoples' Liberty BillSeptember 2487September 2487defeated
Local Hunting BillFebruary 2487June 2488passed
Cultural Localization BillFebruary 2487October 2487defeated
Waste Disposal Gradual Privatization ActFebruary 2487May 2487passed
Budget proposal of February 2487February 2487February 2487defeated
Cabinet Proposal of December 2486December 2486December 2486passed
Enforced Civil Rights ProtectionMarch 2486March 2486defeated
Countryside Protection BillMarch 2486March 2486defeated
Nuclear Holocaust Prevention ActMarch 2486March 2486defeated
Cabinet Proposal of March 2486March 2486March 2486defeated
Emperor BillMarch 2486March 2486defeated
Justice Reform BillSeptember 2485September 2485defeated
Foreign Policy ReformJanuary 2485July 2485passed
Computer Reform BillJanuary 2485July 2485passed
Environmental Reform BillJanuary 2485July 2485defeated
Amended Eminent Domain ReformJanuary 2485July 2485passed
Public Intercourse BillJanuary 2485July 2485passed
Call for early elections, January 2485January 2485January 2485passed
Cabinet Proposal of February 2484February 2484June 2484defeated
Union Strike BillFebruary 2484March 2484defeated

Random fact: You can view helpful ideological statistics about the regions in your nation on the region pages. You can also view detailed political opinions and the importance of them there as well.

Random quote: "Let us not seek to satisfy our thirst for freedom by drinking from the cup of bitterness and hatred." - Martin Luther King Jr.

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51