Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5477
Next month in: 02:25:07
Server time: 05:34:52, May 02, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Saridan Democratic Union[?]

This page contains information about the Saridan Democratic Union.

This party is inactive.

Details

User[?]: unionsocialist

Nation[?]: Federale Republiek van Seridjan (Saridan)

Seats[?] in Volksraad (People's Council)[?]: 0

Color[?]:

 

Description[?]:

"The Other nation in a Nation"
"The Other Side of the Nation"
"The Other Saridan"
"Rise up all oppressed peoples, you only have your chains to loose"
"Tired of Death, hand us liberty"
A few of the Party Slogans

The Saridan Democratic union (The Other Nation Coalition before 4425) was founded in April 4417 as a coalition of several Anarchist and Socialist groups that seeks to form an opposition in the Saridan Parliament and establish a democratic and equal system of governing.

Ideology: Democratic Socialism, Anarchism, Civil Rights advocacy, Anarcho-Warrenism, collectivism, Metzism, Federal Collectivism, Democratic Confederalism

Party Compass: https://www.politicalcompass.org/crowdchart2?spots=-8.25%7C-8.05%7C

Free all opressed peoples. Long live the Struggle, the Other Nation is of all oppressed groups, a national front for liberty, democracy and the pursuit of happiness.

The Saridan Democratic Union stands for
1. The devolvement of the state
2. the promotion of workers collectives, coops and union organization
3. A free and democratic society based in equality for all, free and fair access to the needs of the many
4. A confederation of communes




*Anti war

*Anti Bigotry

*Anti Capitalism

*Anti Nationalism

*Pro Democracy

*Pro Cooperation

*Pro Equality

*Pro Peace

Party Flag (of the original coalition(Inverted Colours of the National flag, to symbolize the opposition to the regime and that they stand with the oppressed people in the Nation): https://imgur.com/a/Ackt6zP)

Part of Speech by Jaun Isaac on the Foundation congress of the Other nation Coalition

"They say Saridan first, they say that they want us all well and good, what do they mean by this? This regime have participated in the destruction of everyones livelyhood, they have restricted civil and social rights, we are not to be fooled by the reactionaries, when they say Saridan First they mean the ruling class of Saridan first, they mean the reactionary social order first, they do not mean the people first, they have a deep hatred for you all, we have to break down their barriers for our own freedom. Together we must work to secure a brighter and freer tomorow for all People. Poor, LGBTQ+, immigrants, all oppressed groups have to unite and fight, we must show that this is not okay and that the people will no longer allow this rampant fascism to exist, we are the People of the other Nation! We have died enough, TIME FOR LIBERTY!"

"THEY SAY MAKE SARIDIAN GREAT AGAIN, WE HAVE BEEN UNDER THEIR RULE, WE KNOW THAT NOTHING HAVE GONE TO THE BETTER, OPPRESSION AND POVERY RUNS THROUGH SOCIETY. LONG LIVE THE STRUGGLE"

Spreading propaganda and handling black market activities out of necessesity as the law in Saridan makes it in effect illegal to critique the government

After the Saridian revolution of 4425 the Group reorganized as the Saridan Democratic Union

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalisthighperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketconvinced regulatorhighperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate progressivehighperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 442118,171,74743,562,97241.71+41.7121450042.80+214
January 442515,551,90753,350,90729.15-12.5615550031.00-59
January 442912,045,36712,075,06499.75+70.60500500100.00+345
January 443311,992,15712,017,34599.79+0.04500500100.00+0
January 443751,795,26265,825,63578.69-21.1039650079.20-104
January 44418,044,45022,968,50635.02-43.6625350050.60-143

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Saridan Democratic Union.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392

BillCreatedVoting startedVoteBill StatusResult
Income tax proposal of February 3378February 3378February 3378passed
Reform Bill of 3378February 3378February 3378passed
Cabinet Proposal of July 3376July 3376July 3376passed
Energy and TOC Administration: State over PrivateMay 3376October 3377defeated
Red BillMay 3373May 3373defeated
Cabinet Proposal of December 3372December 3372May 3373defeated
Motion for the Renaming of the ParliamentNovember 3372May 3376passed
Revision Act No.4January 3371January 3371defeated
Red ProposalMay 3370June 3370defeated
Reform Bill of 3369June 3369June 3369passed
Reform Bill 3365November 3365November 3365passed
Revision Act No.3April 3365April 3368passed
Revision Act No.2December 3363July 3364passed
Red proposalNovember 3363September 3364defeated
Budget proposal of November 3363November 3363November 3363passed
Eminent Domain ReformJanuary 3362January 3362passed
ReformsNovember 3361May 3362passed
Revision Act No.1November 3361November 3361passed
Red ProposalNovember 3361November 3361defeated
Ratification of the Openning An Embassy in Jakania PolicyMay 3361May 3361defeated

Random fact: There is a phpBB forum dedicated to Particracy. Please click the Forum link in the top game menu. Additions to the game, suggestions and discussion is held there so get involved. http://forum.particracy.net/

Random quote: "In politics, you have your word and your friends; go back on either and you're dead." - Morton C. Blackwell

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51