Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5475
Next month in: 03:28:22
Server time: 20:31:37, April 26, 2024 CET
Currently online (5): burgerboys | hexaus18 | hexaus19 | Paulo Nogueira | ZulanALD | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberal-Monarchists of Vorona[?]

This page contains information about the Liberal-Monarchists of Vorona.

This party is inactive.

Details

User[?]: Rex_9

Nation[?]: Vorona (Vorona)

Seats[?] in Royal Assembly[?]: 0

Color[?]:

 

Description[?]:

Founded in October 4704, the Liberal-Monarchists of Vorona (LMV) are a party that espouses classical liberal ideas and support for a Voronan monarchy.

LMV is led by Alfred Wheaton, and has the support of Raymond Bavoria, the pretender to the Voronan throne.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketregulator-leaningexcellentperfect
Militaryfanatical militaristlimitedperfect
Moralitymoderate progressivemoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 47066,17124,890,7370.02+0.0202000.00+0
March 47107,263,55225,181,25728.85+28.825820029.00+58

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberal-Monarchists of Vorona.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326

BillCreatedVoting startedVoteBill StatusResult
Organized ReligionJune 3386June 3386defeated
Voting Rights of CriminalsJune 3386June 3386defeated
Sale of Tobacco productsApril 3386April 3386passed
Energy RegulationFebruary 3386February 3386passed
National Health Care policy.November 3385November 3385defeated
The government's policy on advertisingNovember 3385November 3385passed
The total number of seats in the legislative assemblyAugust 3385August 3385defeated
Humane Abortion Act of 3385July 3385January 3386passed
The right for a person to prostitute himself or herself..April 3385April 3385passed
The government's policy concerning diplomatic immunity.April 3385April 3385passed
Cabinet Proposal of April 3385April 3385April 3385passed
Military Reform Act 3385April 3385April 3385passed
Eminent Domain.August 3383August 3383passed
The Legality of DuelingMay 3382May 3382passed
.May 3382May 3382passed
The government's policy on public nudityMay 3382May 3382passed
.April 3382May 3382passed
Weapon concealment ( Act )April 3382April 3382defeated
Cabinet Proposal of April 3382April 3382April 3382passed
The Government's policy regarding bestiality ( Act )April 3382April 3382passed

Random fact: Particracy does not allow real-life brand names (eg. Coca Cola, McDonalds, Microsoft). However, in the case of military equipment brand names it is permitted to use simple number-letter combinations (eg. T-90 and F-22) borrowed from real life, and also simple generic names, like those of animals (eg. Leopard and Jaguar).

Random quote: "Let's not forget that we belong to history, that history that men and women who fought before did, that history that men and women who are fighting now will do." - Tera Pisthis, former Selucian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51