Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5476
Next month in: 02:15:47
Server time: 17:44:12, April 28, 2024 CET
Currently online (4): aai14 | NL | R Drax | ZulanALD | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


People's Revolutionary Party[?]

This page contains information about the People's Revolutionary Party.

This party is inactive.

Details

User[?]: WillC

Nation[?]: Technokratyczna Republika Valruzia (Valruzia)

Seats[?] in Narodowe Zgromadzenie Doradcze Walruzyjskiej Ligi Socjalistycznej[?]: 0

Color[?]:

 

Description[?]:

We are a radical Left wing party who will strongly fight back against the right-wing hordes!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiesmoderate big governmentmoderateperfect
Marketextreme regulatormoderateperfect
Militarymoderate militaristmoderateperfect
Moralitymoderate progressivemoderateperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 252542,61790,957,0330.05+0.0503330.00+0
December 25279,859,56393,415,41010.55+10.513533310.51+35
December 25299,399,03995,363,2399.86-0.704545010.00+10
December 25317,756,89793,260,5218.32-1.54384508.44-7
December 25338,488,75793,801,7019.05+0.73404508.89+2
December 25357,661,91797,089,7777.89-1.16354507.78-5
December 25376,801,83094,649,2627.19-0.71324507.11-3
December 25394,827,16593,476,3865.16-2.02234505.11-9
December 25417,849,61396,476,3448.14+2.97364508.00+13
December 25436,941,21299,813,7746.95-1.18304506.67-6
December 25457,681,92399,846,7747.69+0.74344507.56+4
December 25474,336,65699,196,4644.37-3.32194504.22-15
December 25492,941,745100,771,1042.92-1.45114502.44-8
December 25514,760,508101,242,7744.70+1.78194504.22+8
December 25533,786,747100,827,4503.76-0.95144503.11-5

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the People's Revolutionary Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400

BillCreatedVoting startedVoteBill StatusResult
InformationFebruary 2093February 2093passed
InformationFebruary 2093February 2093passed
Humane TreatmentFebruary 2093February 2093passed
Smart ChoiceMarch 2092March 2092passed
ID CardsMarch 2092March 2092defeated
its like driving behind a dutch guy...September 2091September 2091passed
Relaxing Drinking LawsAugust 2091August 2091passed
ID Cards take 20June 2091June 2091passed
We must understand to protect ourselvesJune 2091June 2091passed
Doctors Flee ValruziaJune 2091June 2091passed
Call for early elections, October 2090October 2090October 2090defeated
Space ExplorationOctober 2090October 2090defeated
InternetOctober 2090October 2090passed
Recreational Drug UseOctober 2090October 2090defeated
Greater RepresentationOctober 2090October 2090defeated
Public OrderSeptember 2090September 2090passed
The Real Eminent Domain SolutionSeptember 2090September 2090defeated
State ServiceAugust 2090August 2090defeated
Democracy In The Economy ReturnsAugust 2090August 2090defeated
Saving The PeopleAugust 2090August 2090defeated

Random fact: Players have a responsibility to differentiate between OOC (out-of-character) and IC (in-character) behaviour, and to make clear when they are communicating in OOC or IC terms. Since Particracy is a role-playing game, IC excesses are generally fine, but OOC attacks are not. However, players must not presume this convention permits them to harass a player with IC remarks that have a clear OOC context.

Random quote: "The people who vote decide nothing. The people who count the vote decide everything." - Joseph Stalin

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51