Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5478
Next month in: 00:56:33
Server time: 03:03:26, May 04, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Jakania Islamic Nationalist Party[?]

This page contains information about the Jakania Islamic Nationalist Party.

This party is inactive.

Details

User[?]: Liberi

Nation[?]: Cakaniye Cumhuriyeti (Jakania)

Seats[?] in Cumhuriyet Meclisi (Assembly of the Republic)[?]: 0

Color[?]:

 

Description[?]:

The Jakania Islamic Nationalist Party is founded on 5 fundamental beliefs:

-Strong Government
-Nationalism
-International Good Will
-Militarism
-Islam


Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate regulatormoderateperfect
Militaryconvinced militaristlimitedperfect
Moralityconservative-leaninglimitedperfect
Religionmoderate religiouslimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 256154,313141,474,1490.04+0.0403500.00+0
July 2564570,974134,235,5530.43+0.3913500.29+1
July 25674,011,638132,815,7113.02+2.6093502.57+8
July 257014,720,269132,192,76511.14+8.123935011.14+30
July 257325,000,288127,744,71019.57+8.446935019.71+30
July 257624,400,647125,361,59719.46-0.116835019.43-1
July 257922,043,826126,601,38017.41-2.056135017.43-7

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Jakania Islamic Nationalist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306

BillCreatedVoting startedVoteBill StatusResult
Budget proposal of September 2249September 2249September 2249defeated
Pro-Jakania BillApril 2249April 2249passed
I like the word Reform Too BillApril 2249April 2249passed
Eminent Domain ActMarch 2249March 2249passed
Museum BillMarch 2249March 2249passed
Software Source Code BillMarch 2249March 2249passed
School Testing ActFebruary 2249March 2249defeated
Reform Act of 2249December 2248December 2248defeated
Prisoner of War ActNovember 2248May 2251defeated
Legal Aid ActNovember 2248May 2251defeated
Home Rule ActNovember 2248May 2249defeated
Health Reform ActAugust 2248August 2248passed
Public Transportation Funding ActAugust 2248August 2248passed
Military Reform BillAugust 2248August 2248passed
Budget proposal of June 2248June 2248June 2248passed
Ratification of the Democratic Governance TreatyJune 2248June 2248defeated
Ratification of the Universal Declaration of Human RightsJune 2248June 2248defeated
Cabinet Proposal of May 2248May 2248May 2248passed
Budget proposal of May 2248May 2248May 2248defeated
Economic Reform Act of 2248April 2248September 2248passed

Random fact: Treaties will be eligible for deletion if they are more than 50 in-game years old and have no currently ratified members.

Random quote: "They should rule who are able to rule best." - Aristotle

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51