Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5492
Next month in: 00:44:55
Server time: 07:15:04, June 01, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Capitalism Now ![?]

This page contains information about the Capitalism Now !.

This party is inactive.

Details

User[?]: Moestasch

Nation[?]: Ikradonian Union (Ikradon)

Seats[?] in Federale Kamer (Federal Chamber)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate regulatormoderateperfect
Militarymoderate militaristlimitedperfect
Moralitymoderate progressivelimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 32087,377,68764,754,09611.39+11.398775011.60+87
November 32118,938,05564,463,29313.87+2.4710775014.27+20
May 32159,670,40262,838,90815.39+1.5211975015.87+12
November 32188,936,08963,027,69114.18-1.2110775014.27-12
November 32228,146,19462,492,42313.04-1.1410275013.60-5
October 32247,626,27460,453,42012.62-0.429875013.07-4
October 32287,624,79760,250,05312.66+0.0410075013.33+2
October 32325,719,07161,316,7599.33-3.33727509.60-28
April 32365,883,23159,292,7179.92+0.607575010.00+3
February 32389,732,41058,770,91016.56+6.6412875017.07+53
February 32427,605,19359,378,21812.81-3.759775012.93-31
February 32464,329,19153,952,1508.02-4.78587507.73-39
February 32509,530,40556,988,55416.72+8.7012375016.40+65
February 325410,329,36262,737,69816.46-0.2612175016.13-2
February 32589,118,34357,314,17215.91-0.5511975015.87-2
February 326210,207,80658,568,01817.43+1.5213175017.47+12
February 326610,701,62752,661,99420.32+2.8915375020.40+22
February 327010,421,88255,841,50018.66-1.6614075018.67-13
February 327411,035,06154,106,11420.40+1.7315175020.13+11
February 327812,110,37762,285,59019.44-0.9514675019.47-5

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Capitalism Now !.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383

BillCreatedVoting startedVoteBill StatusResult
Open Citizenship ActJuly 3483September 3483defeated
Eminent Domain Act of 3483July 3483July 3483passed
Proprietary Software ActJuly 3483July 3483passed
End ExtraditionJuly 3483July 3483passed
Protect Domestic Investors Clause of 3483July 3483July 3483passed
We're Not Sitting Ducks Act of 3483July 3483July 3483defeated
Change back to the way things were.April 3483May 3483passed
Call for early elections, February 3483February 3483February 3483passed
Self censuring!October 3482April 3483defeated
Steps for a Better CountryApril 3482May 3482defeated
Cabinet Proposal of April 3482April 3482April 3482passed
Return to Economic Democracy BillFebruary 3482April 3483passed
Defence Of Our People Act 3481December 3481December 3481defeated
Alcoholic Beverages Act 3481December 3481December 3481passed
Free Market Act 3481July 3481July 3481defeated
Motion to Censure The Conservative Party of IkradonMay 3481May 3481passed
Cabinet Proposal of May 3481May 3481May 3481passed
SCI Religion BillMay 3481May 3481defeated
Child Protection Act 3481April 3481April 3481defeated
Trade Union Powers Act 3481April 3481April 3481passed

Random fact: Information about the population of each country can be found on the Population Information thread: http://forum.particracy.net/viewtopic.php?f=5&t=8663

Random quote: "I start with the premise that the function of leadership is to produce more leaders, not more followers." - Ralph Nader

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51