Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5499
Next month in: 03:57:47
Server time: 12:02:12, June 15, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Communist Party of Lodamun[?]

This page contains information about the Communist Party of Lodamun.

This party is inactive.

Details

User[?]: Comrade3

Nation[?]: Commonwealth of Lodamun (Lodamun)

Seats[?] in National Congress[?]: 0

Color[?]:

 

Description[?]:

Founded in December 2416

The Communist Party of Lodamun (CPL) was founded by radical members of the URP, which wished for a centralized communist republic to replace the monarchy. The party criticizes what was the Five Nations of Lodamun as being too federalist, while now it criticizes the monarchy as holding power from the people. Though there are several differences between the two parties, the CPL is willing to negotiate a coalition with the URP to achieve one mutual interest:
The destruction of the monarchy in exchange for a democratic republic.

The CPL's military wing, the 'Red Coats', currently number only in the hundreds and are considerably ill trained, but this is expected to change after the 2420 legislative elections.

Party Chairman: Tyler N. Lucas
Paty Vice-Chairman: Aaron L. Mahmood

Candidate for Prime Minister: Tyler N. Lucas
Chairman of Legislative Delegation: Sebastian H. Sykes

Party views:
- Centralization: The CPL supports a centralized Lodamun. The CPL believes that only the central government should handle laws, while giving them to the local governments will just endanger civil rights

- Military: The CPL believes believes in a strong military for defense. The CPL advocates the making of weapons of mass destruction to defend Lodamun. The CPL also believes that young men should be drafted, as it gives them an independent spirit.

Party Anthem:

The Internationale

First stanza:

Arise, ye workers from your slumber,
Arise, ye prisoners of want.
For reason in revolt now thunders,
and at last ends the age of cant!
Away with all your superstitions,
Servile masses, arise, arise!
We'll change henceforth the old tradition,
And spurn the dust to win the prize!

Chorus:
So comrades, come rally,
And the last fight let us face.
The Internationale,
Unites the human race.
So comrades, come rally,
And the last fight let us face.
The Internationale,
Unites the human race.

Second stanza:

No more deluded by reaction,
On tyrants only we'll make war!
The soldiers too will take strike action,
They'll break ranks and fight no more!
And if those cannibals keep trying,
To sacrifice us to their pride,
They soon shall hear the bullets flying,
We'll shoot the generals on our own side.

Chorus:
So comrades, come rally,
And the last fight let us face.
The Internationale,
Unites the human race.
So comrades, come rally,
And the last fight let us face.
The Internationale,
Unites the human race.

Third stanza :

No saviour from on high delivers,
No faith have we in prince or peer.
Our own right hand the chains must shiver,
Chains of hatred, greed and fear.
E'er the thieves will out with their booty,
And to all give a happier lot.
Each at his forge must do their duty,
And we'll strike the iron while it's hot.

Chorus:
So comrades, come rally,
And the last fight let us face.
The Internationale,
Unites the human race.
So comrades, come rally,
And the last fight let us face.
The Internationale,
Unites the human race.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiesbig government-leaningexcellentperfect
Marketextreme regulatorexcellentperfect
Militarymoderate militaristlimitedperfect
Moralitymoderate progressiveexcellentperfect
Religionconvinced secularexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 241750,28878,573,3530.06+0.0605990.00+0
February 242013,734,83881,839,95016.78+16.7210159916.86+101
September 242212,886,84682,399,95615.64-1.149559915.86-6
April 24259,953,87982,610,75012.05-3.597359912.19-22
April 242816,842,91277,263,49821.80+9.7513159921.87+58
August 24296,942,36468,545,48910.13-11.676259910.35-69
August 243210,816,10685,419,60412.66+2.537659912.69+14
April 243515,016,28286,451,16517.37+4.7110359917.20+27

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Communist Party of Lodamun.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593

BillCreatedVoting startedVoteBill StatusResult
Call for early elections, July 4442July 4442July 4442defeated
Revision of Social Security Contributions by Companies ActFebruary 4441May 4442defeated
Female Freedom of Choice ActFebruary 4441May 4442defeated
Market Liberalization Act - 4440October 4440October 4441defeated
Deregulating food sales act - 4439August 4439April 4440passed
Health reform act - 4439August 4439April 4440defeated
Animals Protection ActApril 4439October 4439defeated
Privacy Protection ActApril 4439October 4439defeated
Energy reform act - 4438August 4438January 4439passed
Income tax proposal of November 4437November 4437April 4438passed
Cabinet Proposal of August 4437August 4437August 4437defeated
Cabinet Proposal of August 4437August 4437August 4437passed
Trade is Aid Act II - 4436November 4436August 4437passed
The Progressive Socialist ManifestoOctober 4436October 4439defeated
Eminent Domain Reform Act- 4436May 4436September 4437defeated
Religious Freedom from Taxation Act- 4436May 4436August 4436passed
Incestious Reform Act- 4436May 4436July 4436passed
Free Market Act - 4436March 4436September 4436defeated
Justice Decentralization Act - 4436March 4436September 4436defeated
Safety and Security Act - 4436March 4436September 4436passed

Random fact: The grey space in the east is populated by the forum-based countries, known in-game as the former colonies or the "Third World". These countries are managed by the Third World Coordinator but players can request control of individual countries in the Third World Control Requests thread: http://forum.particracy.net/viewtopic.php?f=11&t=8302

Random quote: "If it were proved to me that in making war, my ideal had a chance of being realized, I would still say 'No' to war, for one does not create human society on mounds of corpses." - Louis Lecoin

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51