Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: March 5499
Next month in: 03:13:54
Server time: 00:46:05, June 15, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Demokrata Partio[?]

This page contains information about the Demokrata Partio.

This party is inactive.

Details

User[?]: generalissimo14

Nation[?]: Respubliko de Zardujo (Zardugal)

Seats[?] in Leĝdonaro (Legislature)[?]: 0

Color[?]:

 

Description[?]:

The Democratic Party is a centre-left party.

The true opposition and voice of the people. We are generally centrist but are left-leaning on economic issues.

Its main policies are:
-Declaring Hosianism the national religion
-Protecting all social minorities, including the LGBT population
-High welfare
-Defending our morality

Its leader is Georgo Darzi.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistlimitedperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketconvinced regulatorhighperfect
Militaryconvinced militaristmoderateperfect
Moralityconservative-leaningexcellentperfect
Religionmoderate secularexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 393911,241,24143,066,66526.10+26.109950019.80+99
October 394119,308,17349,127,56539.30+13.2017750035.40+78
October 394517,799,60543,622,60940.80+1.5021050042.00+33
October 394912,150,63243,759,11227.77-13.0414850029.60-62
August 395115,442,76452,821,73529.24+1.4719265029.54+44
January 395224,854,11241,403,27460.03+30.7937365057.38+181
February 395326,099,06343,325,84660.24+0.2128850057.60-85
June 395512,337,43855,220,69822.34-37.9011050022.00-178
October 395612,439,51558,624,80021.22-1.1210850021.60-2
September 39579,025,72454,298,72816.62-4.608350016.60-25
January 396115,053,44163,398,96623.74+7.1212150024.20+38
January 39656,425,57363,960,29210.05-13.70495009.80-72
October 39666,884,96363,857,41610.78+0.745450010.80+5
July 39685,162,03060,223,4588.57-2.21415008.20-13
July 39726,182,29062,367,9289.91+1.34485009.60+7
July 39764,840,99960,677,8227.98-1.93395007.80-9
November 397717,638,02659,347,92929.72+21.7414950029.80+110
January 397826,615,40055,316,77548.11+18.3923350046.60+84
December 398022,919,74158,889,36938.92-9.1919650039.20-37
July 398231,045,35960,371,97951.42+12.5025950051.80+63
April 398328,045,23658,519,01547.92-3.5024150048.20-18
February 398519,640,54458,567,84433.53-14.3916650033.20-75
July 398823,440,57357,392,99240.84+7.3120550041.00+39
February 399224,125,52160,185,15140.09-0.7620350040.60-2
September 399519,292,21745,570,76942.33+2.2521250042.40+9
January 39966,216,17328,312,60621.96-20.3811650023.20-96
January 400012,822,44162,035,66420.67-1.2915575020.67+39
January 400411,686,39848,954,67823.87+3.2011146523.87-44
January 40085,704,92550,049,92011.40-12.475246511.18-59
September 40108,289,66564,334,43212.89+1.495946512.69+7
March 40148,681,68655,973,70915.51+2.637346515.70+14
March 40188,604,10062,774,25513.71-1.806446513.76-9
March 40228,138,24059,351,29613.71+0.016446513.76+0
March 402317,538,00253,952,99832.51+18.7915146532.47+87
January 402518,243,71852,803,25034.55+2.0415946534.19+8
January 402932,401,92663,698,22350.87+16.3223646550.75+77
January 403311,151,93956,683,55819.67-31.198946519.14-147
January 403710,437,79564,081,57316.29-3.397646516.34-13
January 40418,168,63160,283,36813.55-2.746246513.33-14
June 40439,910,46157,903,72017.12+3.578146517.42+19
June 40479,092,59458,479,07915.55-1.577646516.34-5

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Demokrata Partio.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567

BillCreatedVoting startedVoteBill StatusResult
Imperial Constitution of 3790 (ARCHIVE)January 3782October 3789defeated
Equal Marriage ActJanuary 3782January 3782defeated
Localized Regulation of Farm SizesJanuary 3782January 3782defeated
OOC: Military Protocols for Sekowo (ARCHIVED)December 3781February 3783passed
Ratification of the Majatran Free Trade AgreementSeptember 3781September 3781defeated
Amendment to the ConstitutionSeptember 3781September 3781passed
Dubane IAugust 3781August 3781passed
Amendment To The Foreign Anti-Terror ActJune 3781June 3781defeated
Legislative Accountability ActJune 3781June 3781defeated
Call for early elections, June 3781June 3781June 3781defeated
OOC: Government Finances and Public Debt Information (ARCHIVE)March 3781August 3808passed
Ratification of the Treaty of Surrender and PeaceMarch 3781June 3781passed
Right To Strike ActMarch 3781March 3781defeated
Minority Equality ActMarch 3781March 3781defeated
Ratification of the STAWP – Southern Terra Anti Weapon ProgramAugust 3779January 3780passed
Eminent Domain Reform ActApril 3779March 3781passed
Gambling Devolution ActApril 3779August 3780passed
Police Powers ActApril 3779February 3780passed
Health and Food Safety Devolution ActApril 3779January 3780passed
Labour Reform ActApril 3779January 3780passed

Random fact: Players who consent to a particular role-play by acknowledging it in their own role-play cannot then disown it or withdraw their consent from it. For example, if player A role-plays the assassination of player B's character, and player B then acknowledges the assassination in a news post, but then backtracks and insists the assassination did not happen, then he will be required under the rules to accept the validity of the assassination role-play.

Random quote: "Politics is the entertainment industry for ugly people." - Mark Turpin

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51