Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5496
Next month in: 00:10:53
Server time: 07:49:06, June 10, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Monarchic National Front[?]

This page contains information about the Monarchic National Front.

This party is inactive.

Details

User[?]: Ianos1

Nation[?]: Voronan Federation (Vorona)

Seats[?] in Federal Parliament[?]: 0

Color[?]:

 

Description[?]:

The Monarchic National Front (during the republic National Democratic Front) is a nationalistic center right party. His mission is to promote and defend the monarchy.


Important date:
May 3221: Walter J. Jones won presidential election and the party obtained 46.3% of consensus
June 3224: the party become the largest party of the assembly obtaining 100% of consensus and all seats and Mr. Walter J. Jones was relected President
November 3229: Walter J. Jones was re-elected President. Under his mandate was instituted the monarchy. He was nomitaed Provisional Regent, and he supervised all legislations for the creation of the Monarchy.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninghighperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaninghighperfect
Militarypacifist-leaninghighperfect
Moralitymoderate conservativehighperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 318811,40216,116,9870.07+0.0704500.00+0
May 31922,047,90315,178,47713.49+13.426745014.89+67
May 31962,316,09616,623,95613.93+0.446445014.22-3
May 32001,630,00215,961,51310.21-3.725145011.33-13
May 32041,324,28416,386,4518.08-2.13424509.33-9
May 32082,467,65416,067,32815.36+7.286945015.33+27
May 32112,683,47814,312,38918.75+3.398345018.44+14
May 32153,711,21814,366,46425.83+7.0811745026.00+34
May 32174,071,13814,250,79728.57+2.7421475028.53+97
May 32216,842,22314,746,05846.40+17.8334775046.27+133
June 32243,255,4203,255,420100.00+53.60750750100.00+403
November 32283,396,9923,402,88199.83-0.177474100.00-676
November 32342,827,89612,624,61522.40-77.43187424.32-56

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Monarchic National Front.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327

BillCreatedVoting startedVoteBill StatusResult
Labour and Industry Reform ActJune 5014June 5014passed
Cabinet Proposal of June 5014June 5014June 5014passed
Income tax proposal of September 5013September 5013September 5013defeated
Call for early elections, September 5013September 5013September 5013defeated
Vorona Farmers Relief ActSeptember 5010September 5010passed
Software Innovation InitiativeSeptember 5010September 5010passed
Telecom Expansion ActSeptember 5010September 5010passed
Space Exploration Freedom ActSeptember 5010September 5010passed
Vorona Religious Freedom ActSeptember 5009September 5010passed
Peaceful Assembly ActMarch 5009September 5009defeated
Eminent Domain ActMarch 5009September 5009defeated
Recycling and Animal Welfare ActMarch 5009September 5009defeated
Industry and Labour ActMarch 5009September 5009defeated
Freedom of Information ActMarch 5009March 5009passed
New Government Reform ActFebruary 5009February 5009passed
Vorona Military Science Advancement ActOctober 5008October 5008passed
Government Reorganization ActMarch 5008October 5008passed
End of Soviet Regime ActMarch 5008May 5008passed
Cabinet Proposal of March 5008March 5008May 5008passed
Vorona Treaty Clean Up BillSeptember 5006May 5008passed

Random fact: Never use the same password as a friend. If two or more active accounts use the same password, they will be inactivated.

Random quote: "Non-violence is not a garment to be put on and off at will. Its seat is in the heart, and it must be an inseparable part of our very being." - Mahatma Gandhi

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51