Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5492
Next month in: 01:33:57
Server time: 06:26:02, June 02, 2024 CET
Currently online (1): ADM Drax | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Centrist Union[?]

This page contains information about the Centrist Union.

This party is inactive.

Details

User[?]: papoose

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

The Centrist Union has no overall policy but takes each issue on a one-by-one basis. Our only objective is to make Hobrazia a better country.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationfederalist-leaninglimitedperfect
Civil Rightspermissive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsinternationalist-leaninglimitedperfect
Government Responsibilitiesmoderate big governmentlimitedperfect
Marketregulator-leaninglimitedperfect
Militarymilitarist-leaninglimitedperfect
Moralityconvinced progressivelimitedperfect
Religionreligious-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 210362,62916,994,0670.37+0.3714000.25+1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Centrist Union.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347

BillCreatedVoting startedVoteBill StatusResult
Ratification of the Recongnition of the Republic of New EngliaOctober 2880February 2882defeated
Free the Internet!November 2879November 2879defeated
New National GovernmentNovember 2879November 2879defeated
Legalization of Naturally-Ocurring Psychoactive Substances StatuteNovember 2879November 2879defeated
Military Reform ActNovember 2879November 2879defeated
election platformFebruary 2878February 2878passed
constitutional changeFebruary 2878February 2878defeated
Eminent Domain Act of 2875January 2875January 2875defeated
Health legislation of 2875December 2874December 2874passed
Justice Reform of 2874March 2874December 2874defeated
Religion PackageSeptember 2873July 2874defeated
Merging National Authorities/Creating a joint educationMay 2873July 2874passed
Government Internet Censorship Squadron (GICS)November 2872May 2873passed
National Food Control (NFC)November 2872May 2873passed
Hobrazian Security IssuesJuly 2872May 2873defeated
Income tax proposal of June 2872June 2872June 2872passed
We Say So! Policy StatementJune 2871June 2871passed
Budget proposal of June 2871June 2871June 2871passed
We Say So! Electioneering BillJune 2868June 2868defeated
The People's ProgramApril 2864April 2864passed

Random fact: Party candidates for head of state elections are not visible to the public. This means that you cannot see who will run and who will not, which adds another strategic element to the elections.

Random quote: "I am loyal to the ideas, not to the institutions." - Cyro Aquila, former Selucian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51