Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5563
Next month in: 00:06:39
Server time: 23:53:20, October 31, 2024 CET
Currently online (1): globerton | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Socialist Worker's Party[?]

This page contains information about the Socialist Worker's Party.

This party is inactive.

Details

User[?]: redx3

Nation[?]: Respubliko de Zardujo (Zardugal)

Seats[?] in Supera Konsilio (Supreme Council)[?]: 0

Color[?]:

 

Description[?]:

We will establish a Collective Regime in the Federation. A central rule of the workers. A soviet government where the common voice is heard. A collective rule of the workers.

[Leadership]*HQ located in Belgae, Manio

[Funding]*national bank located in Port Manio, Kalvere

[Funding]*factories located in 432 locations in Belgae, Manio and in 12 locations in Wentworth, Unkassa

[Departments]*located in Kalvere, Karantia, Manio, Raerdein and Unkassa

[Sub-Departments]*located in Darmoth, Elizabethtown, Kalvere City, Port Manio, Celtae, Red Creek, Skara Brae, Vesper, Arkon, Battle Creek, Belgae, Gatineau, Fort Roth, Kent, Portsmouth, Venetium, Kostandian Bay, New Unkassa, Reiketenne and Wentworth.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate restrictiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesconvinced big governmenthighperfect
Marketconvinced regulatorhighperfect
Militaryconvinced militaristmoderateperfect
Moralityconservative-leaningmoderateperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 305168,379,682531,649,63012.86+12.867760012.83+77
June 3055120,368,111525,123,68822.92+10.0613660022.67+59

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Socialist Worker's Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570

BillCreatedVoting startedVoteBill StatusResult
4831 Act of Nonconventional WeaponryDecember 4830October 4831defeated
4831 Act of Social OrderDecember 4830October 4831defeated
Ratification of the Framework and Agreement for a Nuclear-Free Future (FANFF)July 4830July 4830passed
Abolishment of Nuclear Power and Encouragement of Renewables Act (ANPER)June 4828November 4829passed
Federal Accountability and Electoral Reform of 4828June 4828January 4829passed
Imperial Prefect Appointment 4826May 4826May 4826passed
Federal Pollution and Emissions Standards ActJanuary 4826June 4828passed
Cabinet Proposal of December 4825December 4825December 4825passed
Budget proposal of December 4825December 4825December 4825passed
Withdrawal from the Majatran Economic AssociationJune 4824December 4825passed
Amendment to the Federal Statute on Eminent Domain and Related Compensation ActMay 4823June 4827passed
Discouraging Nuclear Power for Future Safety and Security ActMay 4823May 4826passed
Ratification of the The Protection of Terra's MonarchiesMay 4823February 4824passed
Religious Freedom Act of 4825November 4822May 4824passed
OOC: HoG Title FixNovember 4822May 4823passed
Withdrawal from the Trans-Majatran Corridors NetworkJuly 4822November 4822passed
Admittance of Disaster and Climate Refugees ActJanuary 4822November 4826passed
Workers Rights Act of 4824January 4822November 4823passed
National Service ActJanuary 4822April 4823passed
Amendment to Federal Position on Climate ChangeJanuary 4822May 4822passed

Random fact: There is a phpBB forum dedicated to Particracy. Please click the Forum link in the top game menu. Additions to the game, suggestions and discussion is held there so get involved. http://forum.particracy.net/

Random quote: "I have opinions of my own - strong opinions. But I don't always agree with them." - George W. Bush

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51