Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5500
Next month in: 02:09:57
Server time: 05:50:02, June 17, 2024 CET
Currently online (1): Freemarket21 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


BigBoss Party[?]

This page contains information about the BigBoss Party.

This party is inactive.

Details

User[?]: BigBoss

Nation[?]: Jelbék H'ánknstat (Jelbe)

Seats[?] in Bltmojad Knzsrlji Vezr (Council of Royal Advisors)[?]: 0

Color[?]:

 

Description[?]:

We are the BigBoss Party(the former Kalinaz Party of Jelbania). Most of you might remember us. Our aims are the same. LONG LIVE JELBANIA, HER SON IS BACK!
(Party Flag)
http://80.237.164.51/particracy/wiki/index.php/Image:Logobbp.JPG
(Party Site)
http://80.237.164.51/particracy/wiki/index.php/BigBoss_Party

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiessmall government-leaninglimitedperfect
Marketmoderate regulatormoderateperfect
Militaryconvinced militaristlimitedperfect
Moralityprogressive-leaningmoderateperfect
Religionsecular-leaninghighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 2145000.00+0.001210012.00+12
October 21492,970,14720,673,47714.37+14.377350114.57+61
October 21537,693,74825,287,67030.42+16.0615450130.74+81
October 21578,866,46239,365,67922.52-7.9011650123.15-38
October 21617,975,15039,378,13520.25-2.2710750121.36-9
October 216516,082,69333,677,33547.76+27.5023950147.70+132
December 22146,811,89844,950,46215.15-32.607850115.57-161
December 22176,726,60837,935,23617.73+2.5811462518.24+36
December 22206,980,77642,452,09816.44-1.2910462516.64-10
December 22239,095,64650,109,16118.15+1.7111562518.40+11
June 22285,557,33545,484,20312.22-5.937762512.32-38
December 22323,383,71746,351,4787.30-4.92446257.04-33

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the BigBoss Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338

BillCreatedVoting startedVoteBill StatusResult
The Post Office Act of 2484February 2484February 2484passed
The Eminent Domain Act of 2484February 2484February 2484defeated
The Regional Power Grid Act of 2484February 2484February 2484passed
The Fishing Quotas Act of 2484February 2484February 2484passed
The Local Agircultural Policy Act of 2484February 2484February 2484passed
The Pollution Act of 2484February 2484February 2484passed
The Exotic Animals Act of 2484February 2484February 2484passed
The Endangered Animals Act of 2484February 2484February 2484passed
The Pharmecutical Research Act of 2484February 2484February 2484passed
The False Information Act of 2484February 2484February 2484passed
The Teacher Discipline Act of 2484February 2484February 2484defeated
The Children's Freedom Act of 2484February 2484February 2484passed
Democracy on workplace actJanuary 2484May 2484defeated
renewable souces actJanuary 2484May 2484passed
The Pre-School Act of 2484January 2484February 2484passed
The Fair Shot Act of 2484January 2484February 2484passed
The Education Creation Act of 2484January 2484February 2484passed
The National Police Creation Act of 2484January 2484February 2484passed
The Illegal Immigrant Reform Act of 2484January 2484February 2484passed
The Secondary Strike Act of 2484January 2484February 2484passed

Random fact: Any RP law granting extraordinary "emergency powers" or dictator-like powers to a government must be passed by at least a 2/3rds majority, but (like all RP laws) may always be overturned by a simple majority vote of the legislature.

Random quote: “Human rights means doing whatever the fuck you want” - Benji Benandez, former Dranian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51