Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5573
Next month in: 03:14:05
Server time: 00:45:54, November 25, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberal Party[?]

This page contains information about the Liberal Party.

This party is inactive.

Details

User[?]: cake1

Nation[?]: Rzeczpospolita Walruzyjska / Valruzian Republic (Valruzia)

Seats[?] in Sejm Rzeczpospolita Walruzyjska (Sejm of the Valruzian Republic)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketmoderate regulatorhighperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate progressiveexcellentperfect
Religionconvinced secularexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 421313,504,85964,260,28421.02+21.027636021.11+76

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberal Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of November 2593November 2593November 2593defeated
---August 2592August 2592defeated
Budget proposal of March 2592March 2592March 2592defeated
Income tax proposal of March 2592March 2592March 2592defeated
---March 2592March 2592defeated
Religion banApril 2591April 2591passed
CPV Religion billNovember 2590November 2590defeated
Budget proposal of August 2590August 2590September 2591defeated
PopulationAugust 2590September 2591defeated
---May 2590October 2590defeated
Call for early elections, March 2590March 2590March 2590passed
Anti-Bestiality ActOctober 2589October 2589passed
Patriotism ActOctober 2589October 2589passed
Military Industry Reform ActOctober 2589October 2589defeated
CPV Military billApril 2589September 2589defeated
CPV Religion billApril 2589September 2589defeated
CPV Eminent Domain billApril 2589September 2589defeated
CPV Government EmployeesSeptember 2588September 2588defeated
WithdrawOctober 2587October 2587passed
CPV Economy billAugust 2587August 2587defeated

Random fact: In your Message Centre there is a really useful feature which allows you to subscribe to all of the bill debates in your nation. If you use that, then the "Watched Discussions" section will show you every time a new message has been posted on a bill. You can also subscribe to other pages you want to follow, such as your nation message-board, party organisations or bills outside your nation which you are interested in.

Random quote: "I took the initiative in creating the internet." - Al Gore

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51