Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5493
Next month in: 03:11:37
Server time: 20:48:22, June 03, 2024 CET
Currently online (6): DanivonX | Interstellar. | Maarten_saridan | R Drax | SocDemDundorfian | Tayes_Gad | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Anarchia[?]

This page contains information about the Anarchia.

This party is inactive.

Details

User[?]: Bistromathic

Nation[?]: Fürstentum vu Kéimun (Keymon)

Seats[?] in Chamber of Deputéiert / Abgeordnetenkammer / Camera di i Deputati (Chamber of Deputies)[?]: 0

Color[?]:

 

Description[?]:

Anarchia was formed by a number of Anarchist groups who felt that the time was right to compete in elections. It supports minimal government intervention in every area, although there are some divisions within the party on the ideal structure of Keymon's society and economy. Its leaders are elderly twin sisters Deborah and Norah Tesla of the Maddog Liberation Army, who are well-known in Keymon City for their firebrand speeches and extreme political stunts.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsconvinced permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsextreme internationalistlimitedperfect
Government Responsibilitiesconvinced small governmenthighperfect
Marketmoderate laissez-fairehighperfect
Militarymoderate pacifistlimitedperfect
Moralityextreme progressivelimitedperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
November 2487338937,6710.04+0.0401200.00+0
November 2493335,636965,16434.78+34.744312135.54+43
November 2499240,876911,10926.44-8.343312127.27-10

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Anarchia.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426

BillCreatedVoting startedVoteBill StatusResult
Government intelligenceJanuary 2535February 2536defeated
Regulation of school policyJanuary 2535September 2535passed
National Cultural and Historic Sites and Monuments.December 2534December 2541passed
Taxing of the churchFebruary 2534January 2535passed
Fire serviceFebruary 2534April 2534defeated
Domestic Animals OwnershipDecember 2533January 2541passed
Act to reduce corruption in the churchFebruary 2533September 2533defeated
WMD BillNovember 2532May 2533defeated
Government policy concerning the use of pesticides.June 2532December 2534passed
Identity Card PolicyDecember 2531June 2534defeated
Eminent Domain.June 2531December 2533defeated
New national animalJuly 2529October 2530defeated
Reward for the Winning PartyJune 2529June 2532defeated
Taxation of religious institutionsDecember 2528December 2531passed
Miscellaneous billsJuly 2517July 2518defeated
Medical ReformOctober 2516January 2519passed
Red Sunday AccordJanuary 2515October 2515passed
Ratification of the TOA (Terran Olympic Association)February 2514February 2514passed
Ratification of the The Terran FIFA World Cup (TWC)February 2514February 2514passed
Terran Olympic Association & Terran FIFA world cupApril 2513December 2513passed

Random fact: Hundreds of vessels were lost while traversing the cold waters of the Sea of Lost Souls. It is located between Seleya and Majatra.

Random quote: "If an injury has to be done to a man it should be so severe that his vengeance need not be feared." - Niccolo Machiavelli

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51