Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5496
Next month in: 00:47:01
Server time: 23:12:58, June 09, 2024 CET
Currently online (5): botangabrielkizenia | Dx6743 | Klexi | sahelare | Tayes_Gad | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Communist Labour Party[?]

This page contains information about the Communist Labour Party.

This party is inactive.

Details

User[?]: David Goldstein

Nation[?]: Háromoldalú Szövetségi Népköztársaság / Republica Populară Federală Tripartită (New Endralon and Kizenia)

Seats[?] in People's Congress | Népi Gyűlés | Congresul Poporului[?]: 0

Color[?]:

 

Description[?]:

a Trotskyist Political Party with anarchist and soviet revisionist leanings, which struggles on behalf of the working class for peace, socialism and democracy.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightspermissive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketextreme regulatorexcellentperfect
Militarymoderate militaristmoderateperfect
Moralitymoderate progressivemoderateperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 247262,36388,660,0860.07+0.0704990.00+0
June 247441,35987,544,9340.05-0.0204990.00+0
June 247643,53088,098,8420.05+0.0004990.00+0
June 247827,12298,869,1640.03-0.0204990.00+0
June 2480416,84393,955,2110.44+0.4214990.20+1
June 248210,666,10697,345,08610.96+10.515449910.82+53
June 248410,726,24495,800,77811.20+0.245549911.02+1
June 248610,905,58696,227,77311.33+0.145649911.22+1
June 248813,556,29398,265,41613.80+2.467049914.03+14
June 249015,859,568102,222,62915.51+1.727749915.43+7
June 249215,465,30298,623,00215.68+0.177849915.63+1
June 249416,051,169102,975,95815.59-0.097649915.23-2
June 249615,869,866102,219,06615.53-0.067649915.23+0
June 249811,536,197105,047,49010.98-4.545449910.82-22
September 249911,800,600105,370,22611.20+0.225549911.02+1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Communist Labour Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385

BillCreatedVoting startedVoteBill StatusResult
Military reformFebruary 2398June 2398defeated
Administrative reformFebruary 2398June 2398defeated
Cabinet Proposal of February 2398February 2398February 2398defeated
Reform Act of February 2397February 2397February 2397defeated
Forrest Protection ActOctober 2396December 2396defeated
Animal Policy Reform ActOctober 2396December 2396defeated
Special Firearm Squads ActSeptember 2396December 2396defeated
Fedaral Police Dept. ActSeptember 2396December 2396defeated
Eminent Domain Reform ActSeptember 2396December 2396passed
Complementary Pensions ActSeptember 2396December 2396defeated
Religious Education ActSeptember 2396December 2396defeated
Taxation of Religious Institutions ActSeptember 2396December 2396defeated
Drug PolicyMay 2396May 2396passed
The 2396 Corporation Tax BillJanuary 2396February 2396passed
National Parks, Firearms and Organs BillOctober 2395October 2395defeated
De-Sovietisation Constitution BillSeptember 2395January 2396defeated
Reform Act of September 2395September 2395September 2395defeated
Bill to Reform Government Policy Concerning TariffsAugust 2395August 2395defeated
Bill to Reform Government Policy Concerning Border SecurityAugust 2395August 2395defeated
Bill to Reform Government Policy Concerning the Pension SystemAugust 2395August 2395defeated

Random fact: Before creating a party organisation, check to see whether there are any existing organisations which cover the same agenda.

Random quote: Although I understand and respect the intentions behind the gesture, this is not something that is universally understood or appreciated, and it tends to give out a negative impression of our party. ~ Anton Weinreich, General Secretary of the Dorvish Communist Party, pleading with his members to stop burning the national flag

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 56