Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:06:20
Server time: 16:53:39, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Democratic Reform Union[?]

This page contains information about the Democratic Reform Union.

This party is inactive.

Details

User[?]: Zuza

Nation[?]: Res Publica Seluciae (Selucia)

Seats[?] in Senātus Populī[?]: 0

Color[?]:

 

Description[?]:

DRU founded in May 3196 to unite liberal, social liberal, progressive and libertarian politicians.

DRU is strongly secular, pro-individual liberties and support equal opportunities despite gender, race, ethnicity, religion or sexual orientation.

DRU has a flexible position on economical issues, but generally favors a mixed economy (free market with some state-owned and state-subsidized companies and also state subsidies to low-income citizens).

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate regulatormoderateperfect
Militarymoderate militaristlimitedperfect
Moralitymoderate progressivehighperfect
Religionconvinced secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 319823,355,12064,004,83936.49+36.4923464536.28+234
December 320220,159,27653,595,27437.61+1.1223664536.59+2
December 320619,138,39055,128,64134.72-2.9022364534.57-13
December 321022,474,65864,130,26435.05+0.3322764535.19+4
July 321222,379,75662,330,05435.91+0.8623164535.81+4
July 321618,283,02758,323,68431.35-4.5619964530.85-32
July 321820,543,62758,581,22635.07+3.7222364534.57+24
July 322018,553,62755,195,32133.61-1.4525275033.60+29
July 322220,205,43160,628,57233.33-0.2925275033.60+0
July 322412,713,21858,525,76421.72-11.6016675022.13-86
July 322812,650,20259,949,24621.10-0.6215875021.07-8
December 323013,758,44755,596,73524.75+3.6518575024.67+27
December 323416,482,00250,793,21832.45+7.7023675031.47+51
November 323721,725,76952,792,48541.15+8.7030475040.53+68
November 324122,599,94554,806,85441.24+0.0830575040.67+1
November 324514,784,61057,071,96725.91-15.3319275025.60-113
November 324912,254,82955,756,08921.98-3.9316375021.73-29
November 325314,623,35357,630,92925.37+3.3916364525.27+0
May 325713,056,26153,538,64424.39-0.9915864524.50-5
May 326113,487,46454,203,40824.88+0.5016064524.81+2
May 326512,016,43752,185,82423.03-1.8614864522.95-12
May 326911,461,95950,781,31222.57-0.4614664522.64-2
May 327315,192,52564,949,78823.39+0.8215264523.57+6
May 327515,716,25357,864,98127.16+3.7717764527.44+25
May 327910,622,96243,783,05024.26-2.9015864524.50-19
June 328318,122,87152,123,99934.77+10.5122264534.42+64
June 32876,634,57342,598,49615.57-19.1910764516.59-115
June 329115,558,11442,008,10637.04+21.4623964537.05+132
June 329518,320,59455,865,86532.79-4.2421064532.56-29
June 329916,905,20458,860,51428.72-4.0718564528.68-25
June 330315,992,15956,545,69728.28-0.4418164528.06-4
June 330721,205,67556,027,85837.85+9.5724264537.52+61
June 331119,574,91555,875,61635.03-2.8222464534.73-18
June 331515,448,95860,750,79725.43-9.6016464525.43-60
June 331916,354,69665,247,19325.07-0.3616364525.27-1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Democratic Reform Union.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473

BillCreatedVoting startedVoteBill StatusResult
An Act improving the Quality of televising (RSA)November 2678April 2679defeated
An Act on the Sale of Arms (RSA)November 2678February 2679defeated
An Act affirming marriage Policy (RSA)November 2678February 2679passed
'Let's not torture animals to develop better make-up' Act (RSA)July 2678January 2679defeated
Authority of the Imperator (Constitutional Amendment) (RSA)July 2678July 2678passed
An Act reforming governmental Involvement in Schooling (RSA)May 2678November 2678passed
Freedom to Hire PolicyMarch 2678March 2679defeated
Extradition Act (Citizens' Protections) (RSA)February 2678January 2679passed
An Amendment to further the Rights of the Citizenry (RSA)November 2677July 2678passed
An Act to save public Moneys (RSA)November 2677May 2678defeated
An Act on Prayer in Schools (RSA)November 2677May 2678passed
Army Rationalisation Act (Military Control of Operations) (RSA)November 2677May 2678defeated
Compensation Act on Compulsory Acquisitions (Eminent Domain) (RSA)November 2677May 2678passed
CP: Genetically Modified CropsOctober 2677October 2677passed
CP: Democratic Workers CouncilsOctober 2677October 2677defeated
Nationalization of Energy CompaniesOctober 2677October 2677defeated
Drug RegulationOctober 2677October 2677defeated
CP: Organ DonationOctober 2677October 2677defeated
Refugee ReformSeptember 2677September 2677passed
Eminent DomainAugust 2677June 2678defeated

Random fact: Players must never be asked for their Particracy password. This includes Moderation; a genuine Moderator will never ask for your password.

Random quote: "If we accept that a mother can kill even her own child, how can we tell other people to not kill each other? Any country that accepts abortion is not teaching its people to love, but to use any violence to get what they want." - Mother Teresa of Calcutta quotes

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51