Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5487
Next month in: 00:54:08
Server time: 07:05:51, May 23, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Konfederaszia Natsionalnava Truda(KNT)[?]

This page contains information about the Konfederaszia Natsionalnava Truda(KNT).

This party is inactive.

Details

User[?]: Mikhail_BakuninV2

Nation[?]: Trigunskaya Imperiya (Trigunia)

Seats[?] in Императорская Дума; tr. Imperatorskaya Duma (Imperial Duma)[?]: 0

Color[?]:

 

Description[?]:

The National Confederation of Labour is a Syndicalist party.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced isolationistlimitedperfect
Government Responsibilitiesconvinced big governmentexcellentperfect
Marketextreme regulatorexcellentperfect
Militaryunknownclose to noneperfect
Moralitymoderate progressiveexcellentperfect
Religionmoderate secularexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 380938,156,25053,749,35570.99+70.996010060.00+60
November 380935,837,35452,501,39768.26-2.737110071.00+11
October 381022,068,57148,336,50445.66-22.604610046.00-25
October 381224,391,17548,567,49550.22+4.5737975050.53+333
October 381423,923,33650,746,87447.14-3.0835575047.33-24
October 381633,038,26665,012,15750.82+3.6838275050.93+27
October 381827,903,89057,997,23448.11-2.7135775047.60-25

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Konfederaszia Natsionalnava Truda(KNT).

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423

BillCreatedVoting startedVoteBill StatusResult
State RacismNovember 2451November 2451passed
Call for early elections: To elect a new democratic presidentJune 2451June 2451defeated
Building socialism in TriguniaFebruary 2451June 2451defeated
Military Bill 2February 2451February 2451passed
Income tax proposal of January 2451January 2451January 2451passed
Bill to change nameSeptember 2450September 2450defeated
Bill to help prevent dangerous foreigners from entering while maintaining a foreigner-friendly policySeptember 2450September 2450passed
Delegirovaniye PolnomochiySeptember 2450September 2450passed
President BillAugust 2450February 2451defeated
Ban on Eminent Domain BillAugust 2450February 2451passed
Promotion of Decent MoralityJuly 2450November 2450defeated
Cabinet Proposal of July 2450July 2450July 2450passed
Safeguarding Trigunia against foreign influenceJune 2450August 2450defeated
Ethical Treatment of Prisoners of War BillJune 2450July 2450passed
Domesticated Animals BillJune 2450July 2450defeated
Confidentiality of Letters BillJune 2450July 2450passed
Anthem in Schools BillMay 2450July 2450passed
Fighting ReligionMay 2450July 2450defeated
Planned EconomyMarch 2450July 2450defeated
Call for early electionsFebruary 2450February 2450defeated

Random fact: "Game mechanics comes first." For example, if a currently-enforced bill sets out one law, then a player cannot claim the government has set out a contradictory law.

Random quote: "The root source of wealth is human ingenuity. This has no known bounds, so the amount of wealth in existence can always be increased. That's why capitalism is called 'making money.'" - Marc Geddes

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51