Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 02:03:17
Server time: 17:56:42, November 24, 2024 CET
Currently online (1): globerton | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Yaskovoi Independent Communist Party[?]

This page contains information about the Yaskovoi Independent Communist Party.

This party is inactive.

Details

User[?]: Yaskovoi

Nation[?]: Communauté de Kanjor (Kanjor)

Seats[?] in Chambre des députés (Chamber of Deputies)[?]: 0

Color[?]:

 

Description[?]:

We believe in the great future of our nation and will strive to protect the people.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsrestrictive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistmoderateperfect
Government Responsibilitiessmall government-leaningclose to noneperfect
Marketmoderate regulatorlimitedperfect
Militaryconvinced militaristlimitedperfect
Moralitymoderate progressivelimitedperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 21463,15229,669,2770.01+0.0105990.00+0
March 21492,556,47021,925,56811.66+11.658974911.88+89
March 2152544,59828,371,3221.92-9.74127491.60-77
May 2155891,49128,311,1253.15+1.23217492.80+9
October 21572,208,51730,098,1847.34+4.1971016.93-14

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Yaskovoi Independent Communist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514

BillCreatedVoting startedVoteBill StatusResult
Reform Bill of 2575November 2575November 2575passed
New Military Tech Part IINovember 2571November 2571defeated
New Military TechNovember 2571November 2571defeated
Repeal of Militant BillJanuary 2570January 2570passed
Ratification of the Seleyan UnionNovember 2568November 2568defeated
Budget Proposal of November 2568November 2568November 2568passed
Proposition BL61 - Retour au statu quo en ce qui concerne le mariageNovember 2568November 2568passed
Ratification of the Macon-Selaya Cooperation InitiativeMay 2568November 2568defeated
Militant Bill of May 2568May 2568May 2568passed
Reformation of the SenateJanuary 2568March 2568defeated
Emminant Domain Compensation Act of July 2567July 2567January 2568passed
Public Transport Subsidy Bill of July 2567July 2567January 2568passed
Crossdressing Localization Act of July 2567July 2567January 2568passed
Safe Assembly Act of July 2567July 2567January 2568passed
National Flag Act of July 2567July 2567January 2568passed
Library Localization Act of July 2567July 2567January 2568passed
National Anthem Act of July 2567July 2567January 2568passed
Higher Education Tuition Act of July 2567July 2567January 2568passed
Capital Punishment Act of July 2567July 2567January 2568passed
Police Torture Reversal Act of July 2567July 2567January 2568passed

Random fact: Role-play is most enjoyable and successful when there is good communication and friendly relations between all players involved.

Random quote: "Politics is too serious a matter to be left to the politicians." - Charles de Gaulle

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51