Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5495
Next month in: 00:15:48
Server time: 15:44:11, June 07, 2024 CET
Currently online (2): ImperialAloria | Luzzina | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Market Socialist Party[?]

This page contains information about the Market Socialist Party.

This party is inactive.

Details

User[?]: Glasgia

Nation[?]: Kingdom of Hutori (Hutori)

Seats[?] in House of Parliament[?]: 0

Color[?]:

 

Description[?]:



We are:
Democratic
- We stand against totalitarianism, monarchism and dictatorship as a party of the people. We believe that power is derived from the people and therefore should be possessed by the people.
Libertarian
- We stand for the rights of the people, for their own free will against authoritarianism and for liberty.
Socialist
- We stand for a re-organisation of society and industry, introducing economic democracy. We believe all profit comes from labour and therefore all profit must go to the labourers. This leads the party to strive for a fully democratic economy, which benefits the workers through worker co-operatives and extensive welfare programs. With these steps completed, a truly equal and free state can be created in order to serve the wills of the people, whatever the people's gender, sexuality, race, religion or background.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalisthighperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketconvinced regulatorexcellentperfect
Militarypacifist-leaningmoderateperfect
Moralityconvinced progressiveexcellentperfect
Religionconvinced secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 349938,43163,193,1630.06+0.0603910.00+0
May 3502987,97759,891,6741.65+1.5963911.53+6
May 350548,83860,161,4810.08-1.5703910.00-6
May 35085,953,34955,379,49110.75+10.674239110.74+42
June 35095,891,81957,945,66110.17-0.58393919.97-3
June 35125,747,46862,863,6859.14-1.03353918.95-4
July 35156,168,91062,442,7419.88+0.74373919.46+2
July 35184,919,72761,590,9877.99-1.89587497.74+21
June 35205,189,47560,988,3958.51+0.52627498.28+4
June 35235,548,71258,042,6029.56+1.05707499.35+8
June 35268,268,55361,157,62913.52+3.9610174913.48+31
June 35296,067,39356,631,74710.71-2.817974910.55-22

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Market Socialist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911

BillCreatedVoting startedVoteBill StatusResult
Corporal Punishment BillOctober 3896April 3897defeated
Public Transport BillOctober 3896March 3897passed
Trade Union Reform BillOctober 3896March 3897passed
Religious Education BillOctober 3896March 3897passed
State Defence Industries BillOctober 3896March 3897passed
Drugs Legislation BillAugust 3896October 3896defeated
Abolition of the Death PenaltyMarch 3896April 3896defeated
Work in Prisons Act 3896March 3896March 3896passed
Private Executions Act 3896March 3896March 3896passed
Medical Cannabis Act 3896March 3896March 3896passed
Advertising DeregulationFebruary 3896March 3896defeated
Cabinet Proposal of January 3896January 3896January 3896passed
Snap Elections 3895September 3895September 3895passed
Vaccination BillAugust 3895February 3896passed
Smoking BillAugust 3895February 3896defeated
Abortion Funding ActAugust 3895February 3896passed
Eminent Domain Reforms 3985August 3895November 3895defeated
Removing Diplomatic ImmunityAugust 3895November 3895defeated
Dueling Reforms 3895August 3895November 3895defeated
Torture Reforms 3894November 3894November 3894defeated

Random fact: The Real-Life Equivalents Index is a valuable resource for finding out the in-game equivalents of real-life cultures, languages, religions, people and places: http://forum.particracy.net/viewtopic.php?f=11&t=6731

Random quote: "Africa is poor because its investors and its creditors are unspeakably rich" - Naomi Klein

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51