Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5500
Next month in: 03:50:16
Server time: 08:09:43, June 17, 2024 CET
Currently online (2): j9999 | Ost | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


National Party Of New Endralon[?]

This page contains information about the National Party Of New Endralon.

This party is inactive.

Details

User[?]: Nilocy

Nation[?]: Republica Chizână (New Endralon and Kizenia)

Seats[?] in Parlamentul Republicii (Republic's Parliament)[?]: 0

Color[?]:

 

Description[?]:

We were created under the oath to protect New Endralon. We see that there are people outside, and inside, that wish to destroy our great country. We've taken the stand to stop such nonesense. And wish others will join!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaningmoderateperfect
Militaryconvinced militaristmoderateperfect
Moralitymoderate progressivelimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 237889,48474,300,7270.12+0.1206660.00+0
December 23815,433,89474,381,0167.31+7.19476667.06+47
March 23856,654,37172,973,4399.12+1.81596668.86+12
May 238810,530,42673,517,59814.32+5.209566614.26+36
July 239110,910,94367,333,40116.20+1.8811066616.52+15

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the National Party Of New Endralon.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385

BillCreatedVoting startedVoteBill StatusResult
Drug Saftey ActJuly 2171July 2171defeated
Foreign Investment Approval ActFebruary 2168February 2168defeated
Limited Animal Research BillFebruary 2168February 2168passed
Assumed Consent BillJanuary 2168February 2168defeated
Free Public TransportationJanuary 2168February 2168passed
Alcohol Regulation ActJanuary 2168February 2168defeated
Passport Security CheckJanuary 2168February 2168defeated
Eminent Domain Compensation ActJanuary 2168February 2168defeated
Foreign Missionary Registration ActJanuary 2168February 2168defeated
Separation of Government Officials and ReligionJanuary 2168February 2168defeated
Media ShakeupApril 2163April 2163defeated
Tobacco & AlcoholJanuary 2159September 2162defeated
Revitalising the EconomyJanuary 2159September 2162defeated
RCP ManifestoJanuary 2159September 2162defeated
Tree-HuggingOctober 2158October 2158passed
LSE Reforms for a Democratic EndralonAugust 2157August 2157passed
Reduction of State Interference Act 6June 2157June 2157passed
Women\'s Rights Act 4June 2157June 2157passed
Call for early elections, April 2157April 2157April 2157defeated
A Great Big Gun Aimed At LSEJuly 2155August 2157defeated

Random fact: Party organizations are eligible for deletion if they are over 50 in-game years old, do not have at least 1 active member or are historically significant and possess historically significant information.

Random quote: "The only difference between the Republican and Democratic parties is the velocities with which their knees hit the floor when corporations knock on their door. That's the only difference." - Ralph Nader

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51