Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5492
Next month in: 02:23:38
Server time: 09:36:21, June 02, 2024 CET
Currently online (5): ARK101mz | botangabrielkizenia | botangabriellodamun | Morman Horthy | VojmatDunD | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Imperial Party of Selucian[?]

This page contains information about the Imperial Party of Selucian.

This party is inactive.

Details

User[?]: felixdeus

Nation[?]: Principatus Selucianus (Selucia)

Seats[?] in Senātus Populī[?]: 0

Color[?]:

 

Description[?]:

Imperial Party of Selucian

The Imperial Party of Selucian [ IPS ] , believes in monarchy and a strong empire.

We think economy shall have as much free expansion and room for development as it does not imperil our beloved empire.

The best way to live in peace is a strong army as well as a strong police.

The following characterises our party:

Civil Rights: Restrictive
Ecology: Environmentalist
Education: Public
Foreign Relations: Internationalism
Government Responsibilities: Big Government
Market: more or less Capitalism
Military: Aggressive
Morality: Progressive
Penal System: Rehabilitation/Repression
Religion: Secular
Representation: Autocracy

For more informations you may click here:
http://particracy.wikia.com/wiki/House_of_Assedo

http://particracy.wikia.com/wiki/Selucia

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationconvinced unitaristhighperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiesmoderate small governmenthighperfect
Marketregulator-leaninghighperfect
Militaryconvinced militaristmoderateperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 2088609,9426,852,7888.90+8.9081008.00+8
March 20914,596,11827,538,73416.69+7.791710017.00+9
March 20955,501,48424,536,99622.42+5.738138521.04+64
March 20995,139,52823,128,27722.22-0.208738522.60+6
March 21035,955,24422,569,39226.39+4.1610338526.75+16
March 21074,320,77722,899,79318.87-7.527338518.96-30
October 21095,523,42625,449,58921.70+2.848338521.56+10
October 21137,637,98232,162,57923.75+2.049138523.64+8
October 21177,657,20625,990,30129.46+5.7117257529.91+81
October 21219,211,20326,018,86135.40+5.9420457535.48+32
October 21259,361,45518,497,13650.61+15.2129357550.96+89
October 21296,349,67628,350,89322.40-28.2112657521.91-167
April 21494,051,61135,471,10011.42-10.976557511.30-61
October 21524,134,85234,349,09412.04+0.627057512.17+5
April 21565,019,54437,041,11313.55+1.517957513.74+9
October 21594,228,10339,368,74310.74-2.816257510.78-17
April 21635,449,15736,997,38414.73+3.998557514.78+23
October 21644,754,85534,751,53013.68-1.057857513.57-7
April 21685,561,79536,317,59815.31+1.638857515.30+10
October 21716,907,81541,718,02616.56+1.249457516.35+6
April 21754,066,46639,929,98010.18-6.375957510.26-35
October 21783,289,17540,185,5298.18-2.00475758.17-12
April 21823,618,03341,866,8808.64+0.46525759.04+5
October 21855,562,03441,577,69213.38+4.747757513.39+25
April 218913,079,24946,800,41927.95+14.5717059928.38+93
October 21926,295,17345,944,96113.70-14.257759512.94-93
April 21965,459,33443,197,69712.64-1.066959511.60-8
October 21994,502,90841,888,13710.75-1.89595959.92-10
April 22035,387,64046,890,03611.49+0.746560510.74+6
October 22064,021,76547,317,9308.50-2.99486057.93-17
October 22136,069,08248,874,46912.42+3.927060511.57+22
April 22176,961,21449,109,97214.17+1.768060513.22+10
October 22206,968,42948,886,16314.25+0.088060513.22+0
April 22247,125,90245,234,85415.75+1.509160515.04+11
October 22277,179,08145,863,73715.65-0.108960514.71-2
April 22315,269,08744,516,19111.84-3.826660510.91-23
October 22345,166,21243,364,66611.91+0.086760511.07+1
April 22385,486,98444,262,30312.40+0.486760511.07+0
October 22485,756,96553,863,19110.69-1.71486057.93-19
April 22528,870,16038,218,61323.21+12.5213460522.15+86
October 225510,493,39936,567,96028.70+5.4916360526.94+29
April 225915,070,54850,769,15429.68+0.9916860527.77+5
October 226214,261,36055,748,85125.58-4.1014560523.97-23
April 226614,766,59154,885,65826.90+1.3215660525.79+11
December 232318,381,21160,541,25330.36+3.463912531.20-117
December 232815,417,79357,851,59726.65-3.716122527.11+22
December 233318,631,89766,065,71228.20+1.556522528.89+4
May 233517,071,98664,829,44026.33-1.876122527.11-4
September 233716,960,26365,711,87125.81-0.525922526.22-2
April 234216,770,99965,349,52225.66-0.155922526.22+0
November 234611,373,17163,088,05018.03-7.643922517.33-20
September 236511,443,51147,616,06424.03+6.015522524.44+16
April 23707,890,20965,096,20612.12-11.912822512.44-27
November 237432,010,04652,786,44960.64+48.5213522560.00+107
July 237714,555,05014,588,71599.77+39.13225225100.00+90
August 237714,588,23714,635,59999.68-0.09225225100.00+0
August 238382,638,76182,940,87999.64-0.04225225100.00+0
October 238727,973,04682,097,83434.07-65.5611431536.19-111
October 239125,270,73774,902,91733.74-0.3311131535.24-3
October 239527,257,30683,796,06632.53-1.2110731533.97-4
March 243218,019,47197,927,76518.40-14.139150018.20-16
March 243621,667,96793,561,10623.16+4.7611750023.40+26
May 249610,313,445111,653,2879.24-13.92455009.00-72
May 250012,331,133117,824,78410.47+1.235350010.60+8
May 25044,604,559117,295,8083.93-6.54185003.60-35
May 25084,130,551117,825,3643.51-0.42155003.00-3
May 251216,188,201114,621,16614.12+10.627050014.00+55
May 251613,302,573114,271,10711.64-2.485750011.40-13
May 252011,521,562114,999,01710.02-1.62495009.80-8

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Imperial Party of Selucian.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472

BillCreatedVoting startedVoteBill StatusResult
VBS - Election Term ActDecember 2323December 2323nodefeatedwon
Call for early elections, October 2322October 2322February 2323abstaindefeatedabstained
Patter Proposal V (e)October 2322October 2322abstainpassedabstained
Patter Proposal V (d)October 2322October 2322abstaindefeatedabstained
Patter Proposal V (c)October 2322October 2322abstaindefeatedabstained
Patter Proposal V (b)October 2322October 2322abstainpassedabstained
VBS - Decent Management ActJuly 2322December 2323nodefeatedwon
An Act to ensure Readiness and Preparedness (IPP)January 2322November 2322abstainpassedabstained
IPS - Administration Act // 2321December 2321December 2323yespassedwon
Security and Stability Act (IPP)October 2321November 2322abstainpassedabstained
New NRP ProposalsOctober 2321October 2322abstaindefeatedabstained
IPS - Border Control Act // 2321September 2321December 2323yespassedwon
IPS - Cosmetic Act // 2321September 2321December 2323yespassedwon
Patter Proposal V (a)May 2321November 2322abstaindefeatedabstained
IPS - Eminent Domain Act // 2320December 2320February 2322yesdefeatedlost
IPS -Pre-School Education. Act // 2320December 2320December 2321yesdefeatedlost
IPS - Museum Act // 2320December 2320December 2321yesdefeatedlost
IPS - Withdraw 2December 2320September 2321yesdefeatedlost
An Act on the funding of Libraries, &c. (IPP)July 2320October 2321yespassedwon
An Act for preventing Tumults and riotous Assemblies, and for the more speedy and effectual punishing the Rioters (IPP)June 2320October 2321yesdefeatedlost

Random fact: "Kubrk" is a Jelbic word that has the colloquial meaning "old man" or "geezer".

Random quote: "Forgive your enemies, but never forget their names." - John F. Kennedy

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51