Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5500
Next month in: 02:23:23
Server time: 09:36:36, June 17, 2024 CET
Currently online (2): AethanKal | Ost | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


National Party Of New Endralon[?]

This page contains information about the National Party Of New Endralon.

This party is inactive.

Details

User[?]: Nilocy

Nation[?]: Republica Chizână (New Endralon and Kizenia)

Seats[?] in Parlamentul Republicii (Republic's Parliament)[?]: 0

Color[?]:

 

Description[?]:

We were created under the oath to protect New Endralon. We see that there are people outside, and inside, that wish to destroy our great country. We've taken the stand to stop such nonesense. And wish others will join!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaningmoderateperfect
Militaryconvinced militaristmoderateperfect
Moralitymoderate progressivelimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 237889,48474,300,7270.12+0.1206660.00+0
December 23815,433,89474,381,0167.31+7.19476667.06+47
March 23856,654,37172,973,4399.12+1.81596668.86+12
May 238810,530,42673,517,59814.32+5.209566614.26+36
July 239110,910,94367,333,40116.20+1.8811066616.52+15

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the National Party Of New Endralon.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385

BillCreatedVoting startedVoteBill StatusResult
Religious Freedom ActJuly 4521July 4521defeated
Restore Sovereignty ActJanuary 4521January 4521defeated
RP: Legionary-Royalist National Revolution of 4523; Restoration of the Eternal LawNovember 4520December 4522passed
Legionary-Royalist Combine (Cabinet Proposal of November 4520)November 4520November 4520defeated
Eminent Domain ActFebruary 4520February 4520passed
Habeas Data ActFebruary 4520February 4520passed
Extradition ActFebruary 4520February 4520passed
Slander ActFebruary 4520February 4520passed
Ratification of the Dolgava Tautas brīvvalsts - New Endralon / Kizenia / Kizauki Bilateral Treaty of Friendship, Commerce and Mutual DefenseJuly 4519July 4519defeated
Daily Working Hours Limitation ActAugust 4518August 4518passed
Respect for Rights of Conscientious Objectors ActJuly 4518July 4518passed
Eminent Domain Abolition ActJuly 4518July 4518passed
Ease of Passport Issuance ActJuly 4518July 4518passed
Freedom to Express Defamatory Opinions ActJuly 4518July 4518passed
RP: Govt Declares 3 National Days of Mourning following death of former Prime Minister Ion Mihai ChizânescuOctober 4517November 4517passed
Stop Police State Surveillance ActOctober 4517October 4517passed
Freedom of Reproduction ActOctober 4517October 4517defeated
Legalize Polyamorous Marriages ActOctober 4517October 4517passed
Freedom from Fear ActOctober 4517October 4517defeated
Full Bestiality Legalization ActOctober 4517October 4517passed

Random fact: There is a phpBB forum dedicated to Particracy. Please click the Forum link in the top game menu. Additions to the game, suggestions and discussion is held there so get involved. http://forum.particracy.net/

Random quote: "Before you embark on a journey of revenge, dig two graves." - Confucius

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51