Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5497
Next month in: 03:51:00
Server time: 08:08:59, June 11, 2024 CET
Currently online (1): Montersis | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Socialist Front of Mordusia[?]

This page contains information about the Socialist Front of Mordusia.

This party is inactive.

Details

User[?]: Grothistan

Nation[?]: Commonwealth of Mordusia (Mordusia)

Seats[?] in National Parliament || The Senate and The Assembly[?]: 0

Color[?]:

 

Description[?]:

February 2172:

New Chairman

After a month-long election in which all registered members of the SFM had a chance to vote, Armando Al-Weizz, a Hosamian councilman for the SFM, was elected chairman of The Socialist Front of Mordusia. While it was a close election to begin with, Al-Weizz came through in the final round with around 69 % of the vote.

July 2171:

Oierathu Resigns!

"During the yearly party congress, the 68 year old Frank Oierathu, who has been the leader of the SFM since its birth, announced his resignation. "I've been with this party from its beginning. I've seen it rise. From an unimportant small party, we have become the third biggest party in Mordusia. Our succes has overwhelmed me. But I stand before you as an old man. I am no longer fit to lead this party. While I have loved my time here, it is time for a new, energetic leader. Thanks to everyone for their support, and good luck to the future leader - Continue our struggle for justice, equality and solidarity."

While it is currently unknown who will be the next chairman of the SFM, popular candidates are Maria Thompson, advisor on Health and Social Services, and Dennis Ferdinand, advisor on Foreign Affairs."

Party History;

The Socialist Front of Mordusia is a libertarian socialist party. It believes in extensive civil rights, a strictly controlled government and police force, universal healthcare, free education and solidarity among the working classes of Mordusia.

It was set up after a convention of workers, trade-unionists, students, artists and intellectuals and middle-class citizens sympathetic to the struggle of the people. Agreeing that unconditional support for the current parties would not be beneficial to the workers cause, and agreeing that a revolution was not possible, it was established that they would set up their own party, and work for changes through the parliament, represented by themselves, through The Socialist Front of Mordusia.

The current chairman of the party is university professor in history, Frank Oierathu. He was democratically elected by a referendum shortly after the party had been set up.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketmoderate regulatorexcellentperfect
Militarypacifist-leaningmoderateperfect
Moralitymoderate progressiveexcellentperfect
Religionmoderate secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
November 216013,74234,386,6400.04+0.0403030.00+0
December 216128,30732,935,8850.09+0.0503030.00+0
November 21623,157,41431,204,68810.12+10.036059910.02+60
May 21663,754,23431,051,05012.09+1.977359912.19+13
May 21674,062,02827,837,18814.59+2.508859914.69+15
November 21707,643,07234,068,04422.43+7.8413459922.37+46
May 21744,216,25032,012,72513.17-9.268059913.36-54
May 21772,805,94233,226,3638.44-4.73505998.35-30

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Socialist Front of Mordusia.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729

BillCreatedVoting startedVoteBill StatusResult
Protect our IndustryOctober 2564October 2564passed
Legislative Reform Bill of 2564October 2564October 2564passed
Immigration Reform Bill IOctober 2564October 2564passed
Income tax proposal of October 2564October 2564October 2564passed
Eminent Domain BillSeptember 2564September 2564passed
Economic Reform Bill For a Better MordusiaJuly 2564July 2564defeated
Military Professionalism ActMay 2564May 2564defeated
Responsible Gun Law of 2563December 2563December 2563defeated
Nationalist Act of 2563December 2563December 2563defeated
Economic Reform Act of 2563December 2563December 2563defeated
Call for early elections, February 2563February 2563February 2563passed
S.P.R. BillSeptember 2562November 2562defeated
Free Enterprise ActJanuary 2560January 2560defeated
Right to Life ActJune 2559November 2559defeated
Reintroduction of the Progressive ManifestoJanuary 2558January 2558defeated
EmbassiesOctober 2556October 2557passed
MLF Progressive ManifestoOctober 2556April 2557defeated
Enviromental Protection ActJanuary 2556January 2556defeated
Equal EducationDecember 2555January 2556passed
Budget proposal of December 2555December 2555December 2555passed

Random fact: In cases where players introduce RP laws to a nation and then leave, Moderation reserves the discretion to declare the RP laws void if they appear to have fallen into disuse. In particular, please bear in mind that a player who is inexperienced with Particracy role-play and has joined a nation as the only party there should not generally be expected to abide by RP laws implemented by previous players who have been and left.

Random quote: "I am loyal to the ideas, not to the institutions." - Cyro Aquila, former Selucian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51