Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: December 5479
Next month in: 00:15:37
Server time: 15:44:22, May 07, 2024 CET
Currently online (4): AethanKal | blowingnorthwind | echizen | JourneyJak | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Dolgarian Liberal Democrats (DLD)[?]

This page contains information about the Dolgarian Liberal Democrats (DLD).

This party is inactive.

Details

User[?]: rokoko12

Nation[?]: Dolgavas Impērija / Dolgavan Empire (Dolgava)

Seats[?] in Dolgavas impērijas parlaments (Imperial Dolgavan Parliament)[?]: 0

Color[?]:

 

Description[?]:

recent decades, the party has adopted a centrist economic and more socially progressive and social democratic agenda, with the voter base having shifted considerably. Today, Democrats advocate more social freedoms, affirmative action, balanced budget, and a free enterprise system tempered by government intervention (mixed economy). The economic policy adopted by the modern Democratic Party, including the former Roland's administration, may also be referred to as the "Third Way". The party believes that government should play a role in alleviating poverty and social injustice and use a system of progressive taxation.
Party Dolgovas Demokrātu Partija position.

1. Party key objectives and tasks of ensuring the welfare of the people, personal freedom and security, and maintain a nation's spiritual values, to promote the flowering of the Dolgovas education, science, economics and the economy, take care of domestic and external security

"Dolgavas Democratic Party"
Programm
1. Prosperity
Population welfare of a country is low. Most Dolgovs capita income levels are lower than the subsistence minimum. The country has not developed economically stable middle. Unemployment in the country is high, and go to work abroad.
1.1. Objectives
Our goal in providing the citizens of social protection are:
1. Public Administration available to enhance the social upbeat and positive, without detracting from any population groups in the social situation.
2. Encouraging economically stable middle class society formation.
3. To encourage people to work in the local market.
4. Stop the labor drain.
5. Reduce poverty in the country population.
1.2. Tasks
Social protection
1. Develop a poverty eradication program.
2. Create a new elderly care centers.
3. The tax rebates to stimulate employers to hire people with disabilities, social-risk group of people.
4. Regularly informing people where and how to seek help and support of various social issues.

Manpower
1. Encouraging young qualified professionals returning to their home areas - regions.
2. Develop a program of "envelope salaries" legalization and workers' social protection.
3. Ensure young people and students to practice in the workplace by giving tax incentives to employers (especially in the regions).
2. Children and Family Affairs
Unfortunately, the number of disadvantaged families the country is increasing. Street children, alcoholism and violence problems in the country is not enough to actively addressed. Citizens are not available in simple and understandable information about the child and family problems and possible solutions for state aid.

Outflow of labor result in a large number of children left without proper care. Children do not receive the necessary attention.
2.1. Objectives
Family-friendly development and the rights of the child has to be given priority. Our goal in defending children's and family rights are:
1. Ensuring effective child protection system, as well as social services and the provision of social support systems.
2. Provide state support for families.
3. Supporting disadvantaged families and street children, etc. problem-solving.
4. Provide accessible information on government support for families, support in crisis situations, advice of child protection issues.
2.2. Tasks
1. It is necessary to ensure the availability of a comprehensive population and understandable information about the child and family affairs of state, local aid available, young people and children free of interest for education and leisure opportunities, as well as adoption issues, sex and a healthy lifestyle.
2. Next to children, family and people with disabilities in the development of an enabling environment - an environment that is favorable to the child's successful development, growth and learning process in which children are protected from violence, from the addictive substances, and games.
3. Children and young people's problems (alcoholism, drug abuse, street children problem, violence) to address the development of effective cooperation between non-governmental organizations, volunteers, young people, parents and the responsible institutions.
4. Encourage parents, teachers, youth organizations, social workers and local government cooperation to monitor and ensure that all children engage in and attend school.
5. Increase of social services and social assistance effectiveness in children and families, as well as children's rights protection.
6. Improve the Maintenance Guarantee Fund, the work of all the ownership records and collected data about the debtor's assets and disposing of it as a good children's teachers.
7. Promote the adoption process as well as a children's home leavers and people with special needs in society.
8. Supporting disadvantaged families purchase teaching materials.
9. Take an effective child and youth protection from violent, the violence induction, pornographic scenes, games and Internet material.
10. Providing free rehabilitation for victims of violence, datoratkarīgajiem and children with drugs, toxic or other intoxicating substance dependence.
11. Continue the provision of rigorous control over the Internet and gaming clubs, as well as to prevent the nightclub access for children.
12. Encouraging children and young people's education and awareness of the socio-political events, as well as crisis situations and relations.
13. Promote youth involvement in children and young people in solving problems in each municipality creating an elected Youth Council (local level). To involve young people in decision-making and enforcement process.
14. To support the family through tax policy, public benefits and government subsidized loans. Promote the establishment of laws, which give preference to families with children.
3. Health
Population health has been disappointing - with high infant mortality, high incidence of cardiovascular disease, short life expectancy. Citizens lack the funds to pay for medicines and a visit to the doctor. Impairs health-related lifestyle habits - mazkustīgums, overweight, stress, alcohol consumption and smoking. Ultimately, the lack of information on the health of conservation opportunities.
3.1. Objectives
Our goal, caring for the health of the population, are:
1. Provide opportunities for a longer preservation of the health population.
2. Providing a healthy living environment.
3. Promote awareness about the importance of maintaining health and a healthy lifestyle.
4. Make the basic health care is available to every citizen.
5. Ensure doctors and nurses responsible sufficient number of health-care system.
6. Develop a family doctor's body as the basis for the health care system that is closest to the population.
7. Provide specialist doctors and medical examinations of the availability of the country.
8. Upgrade the hospital, to ensure speedy and quality treatment.
9. Improve the patient and the doctor of legal relations.
3.2. Tasks
3.2.1. Medicine and Rehabilitation
1. Expand the availability of outpatient medical services in cities and regions.
2. Promote hospital services available to older people.
3. Increase primary health care centers of the country.
4. Build a strong and modern regional hospitals.
5. Increase ambulance crews numbers.
6. To promote home care services are established to ensure the quality and effectiveness of postoperative patients, children, elderly, disabled people's care homes.
7. Develop rehabilitation services for the regions, helping people quickly rebuild its forces and return to work.
8. Ensure effective quality control of treatments in health care facilities.
9. Increase opportunities for patients to participate in the process of treatment while informing them about the progress of treatment, patient rights, medical importance and cost.
10. Reduce Social Stress, depression, suicide, creating a country in crisis centers, and to address mental health problems.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsinternationalist-leaninglimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketregulator-leaningmoderateperfect
Militarymoderate militaristclose to noneperfect
Moralitymoderate progressivelimitedperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 278044,725,89744,725,897100.00+100.00250250100.00+250
January 278241,512,00841,512,008100.00+0.00250250100.00+0
January 278441,441,05241,524,63299.80-0.20250250100.00+0
January 278642,770,53342,906,72999.68-0.12250250100.00+0
January 278845,570,10845,570,108100.00+0.32250250100.00+0
February 279045,405,89045,405,890100.00+0.00250250100.00+0
February 279245,671,30245,820,85899.67-0.33250250100.00+0
February 2794162,965,604169,981,75695.87-3.8023825095.20-12
February 279623,225,318107,555,66921.59-74.287325029.20-165
November 279994,301,055234,388,62740.23+18.6410025040.00+27
November 280352,523,726221,289,27823.74-16.506025024.00-40
November 280748,227,957211,884,08322.76-0.975625022.40-4

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Dolgarian Liberal Democrats (DLD).

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394

BillCreatedVoting startedVoteBill StatusResult
Cabinet Reform ActJuly 2098July 2098defeated
Cabinet Proposal of July 2098July 2098July 2098defeated
Civil Defense Act of 2098July 2098July 2098defeated
Faith Education Act of 2098July 2098July 2098passed
Faith Salary Act of 2098July 2098July 2098defeated
Legalization of Cannabis - Take IIJuly 2098July 2098passed
Eminent Domain Act of 2098July 2098July 2098passed
Porn Allowance ActJuly 2098July 2098passed
National HymnJuly 2098July 2098defeated
Tobacco Control Act of 2098July 2098July 2098passed
Refugee Compassion Act of 2098July 2098July 2098passed
Fire Department Act of 2098July 2098July 2098passed
Education Subsidization Act IIJuly 2098July 2098defeated
Democratic Reform ActNovember 2097November 2097defeated
Health System Reform Act 2097November 2097November 2097defeated
Education Reform Act 2097November 2097November 2097defeated
Criminal Justice Bill 2097November 2097November 2097defeated
Call for early elections, November 2097November 2097November 2097passed
Electoral ReformNovember 2097November 2097defeated
Strike Allowance ActOctober 2097October 2097defeated

Random fact: If you want to leave Particracy, please inactivate yourself on your user page to save the moderation team some time.

Random quote: "If the misery of the poor be caused not by the laws of nature, but by our institutions, great is our sin." - Charles Darwin

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51