Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5477
Next month in: 00:17:41
Server time: 19:42:18, April 30, 2024 CET
Currently online (1): Johnson hill | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Federal Coalition[?]

This page contains information about the Federal Coalition.

This party is inactive.

Details

User[?]: Lord Hanlon II

Nation[?]: Pontesi Hanrapetut’yun (Pontesi)

Seats[?] in Պոնտեսիայի Ազգային ժողով (National Assembly of Pontesi)[?]: 0

Color[?]:

 

Description[?]:

We believe that only the locals, know what will. work for a locality. Our party is devoted to defending the right to use that knowledge

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalistmoderateperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiesmoderate small governmenthighperfect
Marketlaissez-faire-leaninghighperfect
Militaryconvinced militaristlimitedperfect
Moralitymoderate conservativemoderateperfect
Religionmoderate religiousmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 2815115,478214,496,0980.05+0.0506460.00+0
May 2816735,299188,289,6160.39+0.3416460.15+1
July 281713,515,390227,887,2625.93+5.54406466.19+39
December 282125,606,225159,186,39216.09+10.1512575016.67+85
December 282328,992,094174,904,02516.58+0.4912675016.80+1
December 282523,556,403182,290,34912.92-3.659575012.67-31
December 282724,544,176181,928,61813.49+0.5710275013.60+7
December 282913,616,444179,718,2607.58-5.91587507.73-44
December 283121,082,151177,419,76711.88+4.319175012.13+33
December 283322,918,978209,918,27810.92-0.968175010.80-10
December 283519,298,149202,772,3419.52-1.40727509.60-9

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Federal Coalition.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330

BillCreatedVoting startedVoteBill StatusResult
No Cedar ThroneApril 3294April 3294passed
Reintroduction of basic human rightsApril 3294April 3294passed
Restoration of Freedom and DemocracyFebruary 3294February 3294passed
Other's Political Stand of the Resistance Movement.February 3294February 3294defeated
Introducing the ResistanceJanuary 3294February 3294defeated
Paving way for DemocracyJanuary 3294January 3294passed
Cabinet Proposal of January 3294January 3294January 3294passed
M.A.R.C. Special Ordinance: "Obscenity Laws Reform Act"January 3284January 3284passed
M.A.R.C. #53: "Disaster Relief Reform"May 3280May 3280passed
M.A.R.C. #52: "Religious Education Reform Act"May 3274May 3275passed
M.A.R.C. #51: "Urban and Interdistrict Highway Act"December 3272November 3273passed
Call for early elections, July 3270July 3270July 3270defeated
Ecology Policy ActJanuary 3267December 3267defeated
Ratification of the The Law of the SeaJanuary 3267December 3267defeated
Ratification of the The Terran FIFA World Cup (TWC)January 3267December 3267defeated
Ratification of the Indralan-Pontesian Treaty of Friendship and CooperationJanuary 3267December 3267defeated
Ratification of the Pontesi-Rildanor Fellowship TreatyAugust 3265April 3266passed
Ratification of the The Majatran CupAugust 3265April 3266passed
M.A.R.C. #50: "Eminent Domain Compensation Reform"December 3263April 3264passed
Religion Policy Revision ActOctober 3263July 3264defeated

Random fact: If you want to leave Particracy, please inactivate yourself on your user page to save the moderation team some time.

Random quote: "Freedom is not worth having if it does not connote freedom to err." - Mahatma Gandhi

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52